![]() |
||||||
| Home | List proteins by tissue | Protein search | Downloads | Links | ||
| Protein: 328784465 XP_393787.3 PREDICTED: ADP-ribosylation factor 2-like |
Distribution (mouse over here![]() Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | 33.9 | 30.8 | 35.3 | 0.96033996 | 0.8725212 |
| Brain | 37.4 | 62.6 | 0.5974441 | ||
| Crop | 41.2 | 58.8 | 0.70068026 | ||
| Eye | |||||
| Intestine | 28.2 | 32.8 | 39 | 0.72307694 | 0.84102565 |
| Leg, front | 45.7 | 54.3 | 0.8416206 | ||
| Leg, middle | 41.9 | 58.1 | 0.7211704 | ||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 35.2 | 23 | 41.8 | 0.84210527 | 0.5502392 |
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 42.1 | 31.8 | 26 | 1.6192307 | 1.2230769 |
| Malpighian tubules | 28.7 | 43.3 | 27.9 | 1.0286739 | 1.5519713 |
| Nerve chord | 16.2 | 63.4 | 20.4 | 0.7941176 | 3.1078432 |
| Poison sac | |||||
| Sting | 64.5 | 35.5 | 1.8169014 | ||
| Heart | 10.2 | 61.4 | 28.4 | 0.35915494 | 2.1619718 |
| Hypopharyngeal gland | 21.7 | 78.3 | 0.27713922 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 27.8 | 41.5 | 43.6 | 0.63761467 | 0.95183486 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MLKLLNIGIYVLRNDRERIGEAERELANMLKEDELRDAVLLVFANKQDLPNAMSAAELTD KLGLNSLRGRHWYIQSTCATQGHGLYEGLDWLSNELAKK |
|
| |