| Protein: 328792040 XP_003251671.1 PREDICTED: innexin inx2 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 42.3 | 57.7 | 0.73310226 | ||
| Scape | 39.7 | 17.8 | 42.6 | 0.9319249 | 0.41784036 |
| Brain | 43.2 | 56.8 | 0.7605634 | ||
| Crop | 61.2* | 22.1 | 16.7 | 3.6646707 | 1.3233533 |
| Eye | 43.5 | 56.5 | 0.7699115 | ||
| Intestine | 44.7 | 55.3 | 0.80831826 | ||
| Leg, front | 53 | 47 | 1.1276596 | ||
| Leg, middle | 61.5 | 38.5 | 1.5974026 | ||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 45.3 | 25.9 | 28.8 | 1.5729166 | 0.8993056 |
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 53.4 | 12.6 | 34 | 1.5705882 | 0.37058824 |
| Malpighian tubules | 90.9* | 9.1 | 9.989011 | ||
| Nerve chord | 14.7 | 60.2 | 25.1 | 0.58565736 | 2.3984063 |
| Poison sac | |||||
| Sting | |||||
| Heart | |||||
| Hypopharyngeal gland | |||||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 46.4 | 40.1 | 39 | 1.1897436 | 1.0282052 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MFDVFGSVKGLLKLDSVCIDNNVFRLHYKATVIILIAFSLLVTSRQYIGDPIDCIVDEIP LHVMDTYCWIYSTFTIPDRTGVVGKDMVQPGVASHVEGEDEIKYHKYYQWVCFTLFFQAI LFYVPRYLWKTWEGGRIKMLVLDLNCPVMSDEFKSERRKLLVEYFATNWHTQNFYAFRFF LCEVLNFVNVVGQIYFMDFFLDGEFTTYGSDVVKFTEMEPEERIDPMSRVFPKVTKCTFH KYGASGTVQKFDGLCVLPLNIVNEKIYVFLWFWFIILSVLSGLTLAYRAAVIAGPKLRLV LLRARSRLSKPEHINTIAEMCMIGDWFVLYQLGKNIDPVVYQQLVVDLATKLQGKESV |
 Top
| |