| Protein: 66509537 XP_392391.2 PREDICTED: haloacid dehalogenase-like hydrolase domain-containing protein 2-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 33.7 | 34.2 | 32.1 | 1.0498443 | 1.0654205 |
| Scape | 26.3 | 37.3 | 36.4 | 0.72252744 | 1.0247253 |
| Brain | 47.6 | 52.4 | 0.90839696 | ||
| Crop | |||||
| Eye | |||||
| Intestine | 55.2 | 44.8 | 1.2321428 | ||
| Leg, front | |||||
| Leg, middle | 29.3 | 70.7 | 0.41442716 | ||
| Leg, rear | 53.3 | 24.6 | 22.2 | 2.4009008 | 1.1081082 |
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 39.3 | 33.5 | 27.2 | 1.444853 | 1.2316177 |
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | 18 | 82 | 0.2195122 | ||
| Fat body | |||||
| Malpighian tubules | 52.4 | 47.6 | 1.1008403 | ||
| Nerve chord | 31 | 33.3 | 35.7 | 0.86834735 | 0.9327731 |
| Poison sac | |||||
| Sting | |||||
| Heart | 67.1 | 32.9 | 2.0395136 | ||
| Hypopharyngeal gland | |||||
| Galea | |||||
| Glossa | 41.9 | 58.1 | 0.7211704 | ||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 40.7 | 35.1 | 45.2 | 0.9004425 | 0.7765487 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MAKQIKMVLIDLSGTLHIDNTVIPGAVEALNRLRNANIPYKFVTNTSKESSNLLYNRLTK LGFTVKKEEIFSSLIATRKLIISKKLNPMLLIDPHANEDFEDLVKTNETMNAVVIGLAPD KFHYEELTKAFRLLLDGASLIAIQKARYYKRSDGLALGPGAFVAGLEYSANVKAEVIGKP TAEFFKAALGNISPEEAIMIGDDVKDDVAGAQAIGIRGILVQTGKYRDGDENTITPLPTK VCSSFVQAVEYIIKKEI |
 Top
| |