| Protein: 328779472 XP_003249660.1 PREDICTED: hypothetical protein LOC100577682 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | 43.7 | 4 | 52.3 | 0.8355641 | 0.076481834 |
| Brain | |||||
| Crop | |||||
| Eye | |||||
| Intestine | |||||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | 49.7 | 50.3 | 0.98807156 | ||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | |||||
| Sternite | 3 | 86.9* | 10.1 | 0.2970297 | 8.60396 |
| Tergite | 25.6 | 74.4 | 0.34408602 | ||
| Ventriculus | 14 | 86 | 0.1627907 | ||
| Thoracic muscle | |||||
| Fat body | |||||
| Malpighian tubules | 31.5 | 17.5 | 51 | 0.61764705 | 0.34313726 |
| Nerve chord | |||||
| Poison sac | |||||
| Sting | |||||
| Heart | |||||
| Hypopharyngeal gland | |||||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 30.7 | 30.6 | 54 | 0.5685185 | 0.56666666 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MADESQQESQPARKERKIMNYLPFSLKILEIILAVFSIGLIVDPLNSFQKFSTRLHFKLD DAAIIYITIAGYIIINTLFIICQILGDRIPKRTLVIFSSVGALLHIVAGSVIVYNWRKIL GPYYNNEFRPSKQYMDMFISGAVFTFANAVVFILEVFFIIKFSSKGTE |
 Top
| |