| Protein: 110764609 XP_001119960.1 PREDICTED: hypothetical protein LOC725315 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 49.8 | 50.2 | 0.9920319 | ||
| Scape | 36.8 | 16.1 | 47.1 | 0.78131634 | 0.3418259 |
| Brain | 65.6 | 2.7* | 31.7 | 2.0694005 | 0.0851735 |
| Crop | |||||
| Eye | 35.5 | 64.5 | 0.5503876 | ||
| Intestine | 43.7 | 23.6 | 32.8 | 1.3323171 | 0.7195122 |
| Leg, front | 10.8* | 30.6 | 58.6 | 0.18430035 | 0.5221843 |
| Leg, middle | 46.3 | 25.9 | 27.9 | 1.6594982 | 0.9283154 |
| Leg, rear | 23.2 | 15.7* | 61.1 | 0.3797054 | 0.2569558 |
| Mandibular gland | 48.1 | 51.9 | 0.92678225 | ||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 61.2 | 38.8 | 1.5773196 | ||
| Sternite | 29.3 | 32.2 | 38.5 | 0.76103896 | 0.8363636 |
| Tergite | 58.3 | 19.7 | 22 | 2.65 | 0.8954545 |
| Ventriculus | |||||
| Thoracic muscle | 18.1 | 56.7 | 25.2 | 0.71825397 | 2.25 |
| Fat body | 81 | 19 | 4.263158 | ||
| Malpighian tubules | 55.4 | 44.6 | 1.2421525 | ||
| Nerve chord | |||||
| Poison sac | |||||
| Sting | |||||
| Heart | |||||
| Hypopharyngeal gland | |||||
| Galea | 40 | 33.3 | 26.8 | 1.4925373 | 1.2425373 |
| Glossa | 43.3 | 24 | 32.7 | 1.324159 | 0.73394495 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 38.6 | 35.2 | 39.6 | 0.9747475 | 0.8888889 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MSSSSFKELFDVSPKQREIIQWRDARRKELRQKYLKEIHNPMKQTMPVESAVMRLNGLRL QHEYITRVRLYPHLTSAFMLIGSMFAGVLLLTKLKDDNEHLYRTGQISYADREFKFS |
 Top
| |