| Protein: 328786354 XP_392231.2 PREDICTED: hypothetical protein LOC408695 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 35.8 | 26.4 | 37.8 | 0.94708997 | 0.6984127 |
| Scape | 29.4 | 25.3 | 45.3 | 0.6490066 | 0.5584989 |
| Brain | |||||
| Crop | 31.1 | 39.6 | 29.3 | 1.0614334 | 1.3515358 |
| Eye | |||||
| Intestine | |||||
| Leg, front | 36.5 | 33.5 | 30 | 1.2166667 | 1.1166667 |
| Leg, middle | 39.2 | 19.5 | 41.2 | 0.9514563 | 0.47330096 |
| Leg, rear | 17.3 | 39 | 43.6 | 0.39678898 | 0.8944954 |
| Mandibular gland | 37.2 | 62.8 | 0.5923567 | ||
| Rectum | |||||
| Salivary gland, cerebral | 21.4 | 78.6 | 0.27226463 | ||
| Salivary gland, thoracic | 68.1* | 13.4 | 18.5 | 3.681081 | 0.72432435 |
| Sternite | 76 | 24 | 3.1666667 | ||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | |||||
| Malpighian tubules | |||||
| Nerve chord | 40.2 | 32.5 | 27.3 | 1.4725275 | 1.1904762 |
| Poison sac | |||||
| Sting | |||||
| Heart | 28.2 | 71.8 | 0.39275765 | ||
| Hypopharyngeal gland | |||||
| Galea | |||||
| Glossa | 40.9 | 59.1 | 0.69204736 | ||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 36.7 | 32.7 | 43.8 | 0.83789957 | 0.74657536 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MLVSLIPFFLVAQVAVDESVWKHGPEYVFDVEMNITSTPMNHDGVQRFNHTAMNLFCRPK GPDGLSCHLANTRRHSVDLTNDNRMDVSEEEMRQLISSEPFEIKFNEHGVDYLIVNDRIQ VEFLNDVKLISERFNIGVDLNGVPDGTFDILENTTIGQCAVTVGVNHYPSKRMMNKIKNN RYELESLPQLNKVPSETIVIQKTTNLNNCSYYASFYFGSYGAKIVVEPDLHSHLETSTSR IFVSDYQFVSSITRMGTLGSDEKKNLSAISQYVNLSLRDIRAAKRELADIPEPSITTIMA NSEVNRIFPMK |
 Top
| |