| Protein: 5834928 NP_008084.1COX2_10414 cytochrome c oxidase subunit II |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 27.6 | 32.9 | 39.6 | 0.6969697 | 0.8308081 |
| Scape | 43.1 | 13.2 | 43.7 | 0.98627 | 0.3020595 |
| Brain | 37.6 | 62.4 | 0.6025641 | ||
| Crop | 27 | 40.4 | 32.6 | 0.82822084 | 1.2392638 |
| Eye | 12.8 | 28.4 | 58.8 | 0.21768707 | 0.4829932 |
| Intestine | 17.2 | 35.4 | 47.4 | 0.3628692 | 0.7468355 |
| Leg, front | 8* | 35.9 | 56.1 | 0.1426025 | 0.6399287 |
| Leg, middle | 23 | 61* | 16 | 1.4375 | 3.8125 |
| Leg, rear | 17.9 | 23.6 | 58.4 | 0.30650684 | 0.4041096 |
| Mandibular gland | 85.8 | 14.2 | 6.0422535 | ||
| Rectum | 67.1 | 32.9 | 2.0395136 | ||
| Salivary gland, cerebral | 44 | 21.2 | 34.7 | 1.2680116 | 0.610951 |
| Salivary gland, thoracic | 11 | 70.7* | 18.3 | 0.6010929 | 3.863388 |
| Sternite | 35.4 | 15.4 | 49.2 | 0.7195122 | 0.31300813 |
| Tergite | 42.9 | 6.5* | 50.6 | 0.84782606 | 0.1284585 |
| Ventriculus | |||||
| Thoracic muscle | 5.2 | 86.5 | 8.3 | 0.62650603 | 10.421687 |
| Fat body | 39.5 | 29 | 31.5 | 1.2539682 | 0.9206349 |
| Malpighian tubules | 33.4 | 28.1 | 38.4 | 0.8697917 | 0.7317708 |
| Nerve chord | 24.1 | 34 | 41.9 | 0.575179 | 0.81145585 |
| Poison sac | 78.1 | 21.9 | 3.56621 | ||
| Sting | 14.8 | 85.2 | 0.17370892 | ||
| Heart | 25.7 | 33.3 | 41 | 0.62682927 | 0.8121951 |
| Hypopharyngeal gland | 52.6 | 47.4 | 1.1097046 | ||
| Galea | 29.9 | 47.4 | 22.7 | 1.3171806 | 2.0881057 |
| Glossa | 68.3 | 8.3 | 23.5 | 2.906383 | 0.3531915 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 32.8 | 36.3 | 39.1 | 0.8388747 | 0.9283888 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MSTWFMFMFQESNSYYADNLISFHNMVMMIIIMISTLTVYIILDLFMNKFSNLFLLKNHN IEIIWTIIPIIILLIICFPSLKILYLIDEIVNPFFSIKSIGHQWYWSYEYPEFNNIEFDS YMLNYNNLNQFRLLETDNRMVIPMKIPLRLITTSTDVIHSWTVPSLGIKVDAVPGRINQL NLISKRPGIFFGQCSEICGMNHSFMPIMIESTSFQYFLNWVNKQI |
 Top
| |