![]() |
||||||
| Home | List proteins by tissue | Protein search | Downloads | Links | ||
| Protein: 328786319 XP_001122641.2 PREDICTED: synapse-associated protein of 47 kDa-like |
Distribution (mouse over here![]() Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | 32.9 | 27.2 | 39.8 | 0.82663316 | 0.6834171 |
| Brain | 45.5 | 54.5 | 0.8348624 | ||
| Crop | |||||
| Eye | 44.4 | 55.6 | 0.79856116 | ||
| Intestine | |||||
| Leg, front | 80* | 20 | 4 | ||
| Leg, middle | 71.4 | 28.6 | 2.4965036 | ||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 78* | 9.2 | 12.7 | 6.141732 | 0.72440946 |
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | |||||
| Malpighian tubules | 54.1 | 45.9 | 1.1786492 | ||
| Nerve chord | 32.9 | 21.1 | 46 | 0.7152174 | 0.45869565 |
| Poison sac | |||||
| Sting | |||||
| Heart | |||||
| Hypopharyngeal gland | |||||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 47.9 | 44.1 | 37.9 | 1.2638522 | 1.1635884 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MFTGLTNQVSTWMGKKAEDAGTELPPEEKIPVTTEGEELDRKDSPTKSGSKLDMLVGVKS QMTGWFSGGIPGLSRGGQGNEGESQGPKTMNGAQVAQTTTEGTVEPTKDDDASSATGGAD SGPASLEGSPSEDKEGQQAFGGVSTKALAGAKTLGGFLYSAVNKAGKTVVEAGAKIKKTV EENRLVAELNREQEAFIANKHTEKGEAVAPWVGAPNEDILREECLSLSMDQRNFLKSPPK EVDFPWDFEAVQPMAQATLALDPNLENMRFQLVPKVISEENFWRNYFYRVSVLRQSHELN TMANQAENNLNQTSAGTVDQAEVQVTTGQESSGTVMTGSNSALADSPGHEFVSDSMRVSD TDLEEVREGMKKLGMQPPKAEEDWERELEAELKDYEVVTGNEERSSVETPVRSSGALDKD WEKQIDELLANEDDEDLK |
|
| |