| Protein: 328788866 XP_392222.3 PREDICTED: sequestosome-1 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | 35.7 | 64.3 | 0.55520993 | ||
| Brain | |||||
| Crop | |||||
| Eye | |||||
| Intestine | 61.8 | 38.2 | 1.6178011 | ||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 52.8 | 15.5 | 31.7 | 1.6656152 | 0.48895898 |
| Sternite | 47.6 | 52.4 | 0.90839696 | ||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 26.8 | 41.9 | 31.3 | 0.85623 | 1.3386581 |
| Malpighian tubules | 14.8 | 53.5 | 31.7 | 0.46687698 | 1.6876972 |
| Nerve chord | 40.5 | 17.7 | 41.8 | 0.96889955 | 0.423445 |
| Poison sac | |||||
| Sting | |||||
| Heart | 21 | 41.8 | 37.2 | 0.5645161 | 1.1236559 |
| Hypopharyngeal gland | 84.5 | 15.5 | 5.451613 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 31.2 | 44.4 | 38.2 | 0.8167539 | 1.1623037 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MKMFKAYLQNSDFSIKEIRKFNLYPSNLSDKFEVLCNKIKELFPELNHKSFTISWKDNDG DQIVMSSEDELKIAFNEIRNKEVETKYLAIYIKPTIQKEQKSTTNPYQNDLNEKVIHFGI TCDGCDNDIIGFRYKCIQCEDYDLCAQCEAAGIHPHHCMIRMPQPLKWHHSRSLHHHLRK IFKKNGVHLNKKTSSNENKESQGIHCNIYPWFETYAPYLNNFIDALLEVHNVESNSSKVE KKEESKNNSHIDDNDSKKFPGEGRKLFDDTKDDKESVSDVASTTSQDSNPPKVTADEWTI IDTKDTTEANHTASTSSNMNETNEKEKSSSTAPSAPNGTSIYPELPKEKIIHHQNPIINE AVENMIRMGFSNQGGLLTYLLDAENGDINKVLEILQPTNKR |
 Top
| |