| Protein: 328790804 XP_003251465.1 PREDICTED: actin clone 205-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 35.2 | 28.6 | 36.2 | 0.9723757 | 0.7900553 |
| Scape | 37.6 | 32.1 | 30.3 | 1.2409241 | 1.0594059 |
| Brain | 50.1 | 49.9 | 1.004008 | ||
| Crop | 29.4 | 28.8 | 41.8 | 0.7033493 | 0.68899524 |
| Eye | |||||
| Intestine | 31.3 | 38.5 | 30.2 | 1.0364238 | 1.2748344 |
| Leg, front | 35.6* | 49.8* | 14.6 | 2.4383562 | 3.410959 |
| Leg, middle | 22.8 | 51.7 | 25.5 | 0.89411765 | 2.027451 |
| Leg, rear | 44.7 | 43.5* | 11.8 | 3.7881355 | 3.6864407 |
| Mandibular gland | 56.5 | 43.5 | 1.2988505 | ||
| Rectum | 31.8 | 68.2 | 0.46627566 | ||
| Salivary gland, cerebral | 74.5 | 6.3 | 19.2 | 3.8802083 | 0.328125 |
| Salivary gland, thoracic | 41.3 | 26 | 32.7 | 1.2629969 | 0.795107 |
| Sternite | 49.5 | 20.8 | 29.7 | 1.6666666 | 0.7003367 |
| Tergite | |||||
| Ventriculus | 28 | 72 | 0.3888889 | ||
| Thoracic muscle | 41.6 | 58.4 | 0.7123288 | ||
| Fat body | 70.7 | 13.4 | 15.9 | 4.446541 | 0.8427673 |
| Malpighian tubules | 32 | 37.6 | 30.4 | 1.0526316 | 1.2368422 |
| Nerve chord | 43.4 | 25.5 | 31.1 | 1.3954984 | 0.8199357 |
| Poison sac | |||||
| Sting | 38.2 | 61.8 | 0.618123 | ||
| Heart | 24.1 | 43.5 | 32.4 | 0.74382716 | 1.3425926 |
| Hypopharyngeal gland | 33.4 | 66.6 | 0.5015015 | ||
| Galea | 45.3 | 26.2 | 28.6 | 1.5839161 | 0.91608393 |
| Glossa | 37.1 | 23.3 | 39.6 | 0.93686867 | 0.58838385 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 41.3 | 32.3 | 37.8 | 1.0925926 | 0.8544974 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ SKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM TQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAAASTSLEKS YELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETVYNSIMKCDVDIRKDLYANTVL SGGTTMYPGIADRMQKEITALAPSTIKIKIIAPPERKYSVWIGGSILASLSTFQQMWISK QEYDESGPGIVHRKCF |
 Top
| |