| Protein: 48101936 XP_392725.1 PREDICTED: acyl-protein thioesterase 1-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 25.7 | 51.8 | 22.5 | 1.1422222 | 2.3022223 |
| Scape | 26.5 | 36.5 | 37 | 0.7162162 | 0.9864865 |
| Brain | 20.9 | 79.1 | 0.2642225 | ||
| Crop | 47.2 | 52.8 | 0.8939394 | ||
| Eye | |||||
| Intestine | 27.6 | 34.4 | 38 | 0.7263158 | 0.9052632 |
| Leg, front | 49.9 | 50.1 | 0.996008 | ||
| Leg, middle | 42.6 | 57.4 | 0.74216026 | ||
| Leg, rear | 45.6 | 54.4 | 0.8382353 | ||
| Mandibular gland | 27.9 | 72.1 | 0.38696256 | ||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 45.3 | 22.9 | 31.9 | 1.4200627 | 0.7178683 |
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 33.6 | 44.4 | 21.9 | 1.5342466 | 2.0273972 |
| Malpighian tubules | 32.3 | 37.7 | 30 | 1.0766667 | 1.2566667 |
| Nerve chord | 22.2 | 43.7 | 34.1 | 0.65102637 | 1.2815249 |
| Poison sac | |||||
| Sting | 55.7 | 44.3 | 1.2573364 | ||
| Heart | 30.2 | 37.8 | 32 | 0.94375 | 1.18125 |
| Hypopharyngeal gland | 75 | 25 | 3 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 34.1 | 42.3 | 42.7 | 0.79859483 | 0.9906323 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MTTVSPVVIAATARHTATLIFFHGLGDTGHGWASSMGAVRSPHIKVICPTASTMPVTLNA GFRMPSWFDLRSLEPSGPEDEEGIRRAAEMVHSLIAEEVAAGIPTKRIVLGGFSQGGALA IYSALTFPEPLAGIIALSAWLPLHQKFPAEAIGNKNTPLLQCHGDCDPIVPYRWGQLTAS VLKQFMTQTEFKTYRGMMHASCDEEMRDMKKFIEKVLKP |
 Top
| |