| Protein: 66524513 XP_624132.1 PREDICTED: hypothetical protein LOC551742 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 34.9 | 36.7 | 28.4 | 1.2288733 | 1.2922535 |
| Scape | 42.6 | 16 | 41.4 | 1.0289855 | 0.38647342 |
| Brain | |||||
| Crop | 19.2 | 41.6 | 39.1 | 0.4910486 | 1.0639386 |
| Eye | 59.5 | 20.8 | 19.7 | 3.0203047 | 1.0558375 |
| Intestine | 40.1 | 25 | 34.9 | 1.1489972 | 0.7163324 |
| Leg, front | 30.8 | 20.2 | 49 | 0.62857145 | 0.4122449 |
| Leg, middle | 32.9 | 14.3* | 52.9 | 0.62192816 | 0.27032137 |
| Leg, rear | |||||
| Mandibular gland | 60.8 | 39.2 | 1.5510204 | ||
| Rectum | |||||
| Salivary gland, cerebral | 29.4 | 16.4 | 54.2 | 0.5424354 | 0.30258304 |
| Salivary gland, thoracic | 30.3 | 39.7 | 30 | 1.01 | 1.3233334 |
| Sternite | 29.3 | 34.1 | 36.6 | 0.80054647 | 0.931694 |
| Tergite | 70.4 | 29.6 | 2.3783784 | ||
| Ventriculus | |||||
| Thoracic muscle | 28.2 | 55.9 | 15.9 | 1.773585 | 3.5157232 |
| Fat body | 39.1 | 44.6 | 16.3 | 2.398773 | 2.7361963 |
| Malpighian tubules | 41.3 | 22.2 | 36.5 | 1.1315068 | 0.6082192 |
| Nerve chord | 52.2 | 7.8 | 39.9 | 1.3082707 | 0.19548872 |
| Poison sac | |||||
| Sting | 62.9 | 37.1 | 1.6954178 | ||
| Heart | 42.1 | 21 | 36.9 | 1.1409214 | 0.5691057 |
| Hypopharyngeal gland | 63.8 | 36.2 | 1.7624309 | ||
| Galea | 37.7 | 32.1 | 30.2 | 1.2483444 | 1.0629139 |
| Glossa | 43.8 | 22.9 | 33.3 | 1.3153154 | 0.6876877 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 40.2 | 31.5 | 35.1 | 1.1452992 | 0.8974359 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MGSGQSARKLTINNEEIDVIEISESVVERLTQKMNEEKPNVANEVRSATLTDSKKTASSQ LSQSDIPVNAGYPIYQPQLTLTALQIQQQKEKEFRNQDNYWQKRLQDLEQKHSEINNIIN AEYKKAAEQLNANDKDGINAQDTIQPCKSNSDKVFKCYQDYPKEILNCSSLVEEFSNCVD QRRAQVIAAR |
 Top
| |