| Protein: 48104663 XP_392962.1 PREDICTED: receptor of activated protein kinase C 1 isoform 1 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 39.5 | 26.9 | 33.5 | 1.1791044 | 0.8029851 |
| Scape | 36.6 | 36.7 | 26.8 | 1.3656716 | 1.369403 |
| Brain | |||||
| Crop | 23.8 | 46.7 | 29.5 | 0.8067797 | 1.5830508 |
| Eye | 13.1 | 59.5 | 27.4 | 0.47810218 | 2.1715329 |
| Intestine | 24.8 | 43.8 | 31.4 | 0.7898089 | 1.3949045 |
| Leg, front | |||||
| Leg, middle | 14.8 | 50.3 | 35 | 0.42285714 | 1.4371428 |
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | 21.6 | 78.4 | 0.2755102 | ||
| Salivary gland, cerebral | 84.9 | 15.1 | 5.6225166 | ||
| Salivary gland, thoracic | 34.7 | 28.7 | 36.6 | 0.94808745 | 0.784153 |
| Sternite | 29.5 | 29.8 | 40.8 | 0.7230392 | 0.73039216 |
| Tergite | 38.6 | 48.9 | 12.5 | 3.088 | 3.912 |
| Ventriculus | 43.4 | 47.7 | 9 | 4.822222 | 5.3 |
| Thoracic muscle | |||||
| Fat body | 33.6 | 38.2 | 28.2 | 1.1914893 | 1.35461 |
| Malpighian tubules | 37.5 | 23.8 | 38.7 | 0.96899223 | 0.6149871 |
| Nerve chord | 48.8 | 19.9 | 31.4 | 1.5541401 | 0.63375795 |
| Poison sac | 74 | 26 | 2.8461537 | ||
| Sting | 35.6 | 64.4 | 0.55279505 | ||
| Heart | 23.1 | 42.1 | 34.7 | 0.66570604 | 1.2132565 |
| Hypopharyngeal gland | 20.4 | 79.6 | 0.2562814 | ||
| Galea | |||||
| Glossa | 31.5 | 30.7 | 37.7 | 0.83554375 | 0.8143236 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 34.1 | 39.1 | 35.8 | 0.952514 | 1.0921788 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MTETLQLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDEANYGIPQKRLY GHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGRTTRRFEDHTKDVLSVAFSVDNRQI VSGSRDKTIKLWNTLAECKYTIQDDGHTDWVSCVRFSPNHSNPIIVSAGWDKLVKVWNLT NCRLKINHCGHTGYLNTVTVSPDGSLCASGGKDCKAMLWDLNDGKHLHTLDHNDIITALC FSPNRYWLCAAFGPWIKIWDLETKEMVEELKPEVVSATSKAEPPHCLSLAWSTDGQTLFA GYSDNTIRVWQVSVTSR |
 Top
| |