| Protein: 328783193 XP_001120613.2 PREDICTED: dehydrogenase/reductase SDR family member 11-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 17.4* | 39 | 43.6 | 0.39908257 | 0.8944954 |
| Scape | 23.2 | 53.1 | 23.7 | 0.97890294 | 2.2405064 |
| Brain | |||||
| Crop | 32.9 | 2.6* | 64.5 | 0.51007754 | 0.040310077 |
| Eye | |||||
| Intestine | 31.9 | 45.4 | 22.6 | 1.4115044 | 2.0088496 |
| Leg, front | 38 | 27.4 | 34.6 | 1.0982659 | 0.7919075 |
| Leg, middle | 43.2 | 21.1 | 35.7 | 1.2100841 | 0.59103644 |
| Leg, rear | 37.2 | 26.7 | 36.1 | 1.030471 | 0.73961216 |
| Mandibular gland | 51.3 | 48.7 | 1.0533881 | ||
| Rectum | 33.8 | 27.7 | 38.6 | 0.87564766 | 0.71761656 |
| Salivary gland, cerebral | 16.2 | 74.2* | 9.6 | 1.6875 | 7.7291665 |
| Salivary gland, thoracic | 7.1* | 71 | 21.8 | 0.32568806 | 3.2568808 |
| Sternite | 46.3 | 43.5 | 10.2 | 4.5392156 | 4.2647057 |
| Tergite | 76.8 | 8.8 | 14.4 | 5.3333335 | 0.6111111 |
| Ventriculus | 19.3 | 27.1 | 53.6 | 0.36007464 | 0.505597 |
| Thoracic muscle | |||||
| Fat body | 83.4 | 10.9 | 5.7 | 14.631579 | 1.9122807 |
| Malpighian tubules | 52.9 | 7.8* | 39.2 | 1.3494898 | 0.19897959 |
| Nerve chord | 36.9* | 54.1* | 9 | 4.1 | 6.0111113 |
| Poison sac | |||||
| Sting | 9.5* | 90.5 | 0.10497238 | ||
| Heart | 63.7* | 19.7 | 16.5 | 3.860606 | 1.1939394 |
| Hypopharyngeal gland | 99.7* | 0.3 | 332.33334 | ||
| Galea | 53.6 | 22.2 | 24.1 | 2.2240665 | 0.92116183 |
| Glossa | 76.4 | 23.6 | 3.2372882 | ||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 40.3 | 36.6 | 30.3 | 1.330033 | 1.2079208 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MNRWRGKVAMVTGASSGIGAEIAKILVKNGVNVVGVARNMERLEKIGEEIGRNDKFFPVK CDVTREEDILNVFQWIEKKFKGIDILVNNAAIFHTGFFIDQKTEDYRNILDTNLLAPAIF SREAVLSMKKRDAQGHIINISSIAGSHFDAIFVPIGLYGTTKSGMQGLSSELRHEIIQNK LNIKVTSINPGLVTTNMTNDLIKERAKQNICTYSLEAIDIAEAVIYVLETPERVEVPQIT LIPHKSPFILSK |
 Top
| |