| Protein: 66523907 XP_393976.2 PREDICTED: guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1-like isoform 1 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 37.1 | 25.8 | 37.1 | 1 | 0.69541776 |
| Scape | 48.6 | 24.5 | 26.9 | 1.8066914 | 0.91078067 |
| Brain | 31.3 | 68.7 | 0.45560408 | ||
| Crop | 41.1 | 38.7 | 20.2 | 2.0346534 | 1.9158416 |
| Eye | 23.3 | 76.7 | 0.30378097 | ||
| Intestine | 50 | 50 | 1 | ||
| Leg, front | 62.5 | 37.5 | 1.6666666 | ||
| Leg, middle | |||||
| Leg, rear | 53.3 | 46.7 | 1.1413276 | ||
| Mandibular gland | |||||
| Rectum | 12.7 | 87.3 | 0.14547537 | ||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 55.6 | 17.9 | 26.5 | 2.0981133 | 0.6754717 |
| Sternite | 35.2 | 32.4 | 32.5 | 1.083077 | 0.9969231 |
| Tergite | 50.7 | 27.2 | 22.1 | 2.2941177 | 1.2307693 |
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 22.8 | 39.7 | 37.5 | 0.608 | 1.0586667 |
| Malpighian tubules | 33 | 34.7 | 32.4 | 1.0185186 | 1.0709877 |
| Nerve chord | 29.3 | 31.5 | 39.2 | 0.747449 | 0.8035714 |
| Poison sac | |||||
| Sting | |||||
| Heart | 26.3 | 35.5 | 38.2 | 0.6884817 | 0.9293194 |
| Hypopharyngeal gland | 73.9 | 26.1 | 2.8314176 | ||
| Galea | 51.3 | 14.6 | 34.1 | 1.5043988 | 0.4281525 |
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 40.7 | 32.7 | 41.1 | 0.99026763 | 0.79562044 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MSSELESLRQESDKLKNAIRDARKAACDTTLVQATSGMEPIGRIQMRTRRTLRGHLAKIY AMHWGSDSRNLVSASQDGKLIVWDSYTTNKVHAIPLRSSWVMTCAYAPSGSFVACGGLDN ICSIYSLKTREGNVRVSRELPGHTGYLSCCRFYDDNQIVTSSGDMTCALWDIETGQQCTS FIGHTGDVMSLSLAPDTRTFVSGACDASAKLWDIREGTCKQTFPGHESDINAVTFFPNGY AFATGSDDATCRLFDIRADQELAMYSHDNIICGITSVAFSKSGRLLLAGYDDFNCNVWDS MKAERAGILAGHDNRVSCLGVTEDGMAVGTGSWDSFLRIWN |
 Top
| |