| Protein: 48103506 XP_392870.1 PREDICTED: glutaredoxin 3 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 38.2 | 61.8 | 0.618123 | ||
| Scape | 39.7 | 23.7 | 36.7 | 1.0817438 | 0.64577657 |
| Brain | |||||
| Crop | |||||
| Eye | |||||
| Intestine | |||||
| Leg, front | 25.2 | 44.2 | 30.6 | 0.8235294 | 1.4444444 |
| Leg, middle | 29.6 | 42.4 | 28 | 1.0571429 | 1.5142857 |
| Leg, rear | 85.1 | 14.9 | 5.7114096 | ||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | 81.3 | 18.7 | 4.347594 | ||
| Salivary gland, thoracic | 26.4 | 35.9 | 37.7 | 0.7002652 | 0.95225465 |
| Sternite | 41.1 | 32.1 | 26.8 | 1.5335821 | 1.1977612 |
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 27.6 | 30 | 42.4 | 0.6509434 | 0.7075472 |
| Malpighian tubules | 38.6 | 32.3 | 29.1 | 1.3264605 | 1.1099657 |
| Nerve chord | 29.7 | 39.5 | 30.9 | 0.9611651 | 1.2783171 |
| Poison sac | |||||
| Sting | 41 | 59 | 0.69491524 | ||
| Heart | 26.4 | 38.4 | 35.2 | 0.75 | 1.0909091 |
| Hypopharyngeal gland | 78.8 | 21.2 | 3.7169812 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 40.7 | 39.8 | 33.8 | 1.204142 | 1.1775148 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MSVTNLNSQQEYENYVKSQDLSVIHFYAPWADQCSQINDVIEEMSKLTEYKEVKFAKIEA EKIPDVSLKAGISAVPTIIFTRNDTILDRVDGANPSAIADKIKHQLSKKDSISIETYKPK ENLEERLKKLINQAPCMLFMKGSPINPRCGFSRTIVSILDSYKADYQSFDILQDNDVREG LKKFSDWPTYPQLYINGELIGGLDIIKEMSESGELENMLPKKS |
 Top
| |