| Protein: 66555386 XP_624607.1 PREDICTED: translocon-associated protein subunit delta |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | 72.2 | 27.8 | 2.5971222 | ||
| Brain | |||||
| Crop | |||||
| Eye | |||||
| Intestine | |||||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | 15.6 | 84.4 | 0.18483412 | ||
| Salivary gland, thoracic | 45 | 55 | 0.8181818 | ||
| Sternite | 38.9 | 61.1 | 0.63666123 | ||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 22.2 | 29.8 | 48 | 0.4625 | 0.62083334 |
| Malpighian tubules | |||||
| Nerve chord | |||||
| Poison sac | |||||
| Sting | |||||
| Heart | 78.9* | 21.1 | 3.7393365 | ||
| Hypopharyngeal gland | 22.3 | 77.7 | 0.28700128 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 46.4 | 37.1 | 53.6 | 0.86567163 | 0.6921642 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MMKQFISFITLFTLIICGIPEIFGETCQKPEVIASAYITEDATILTNVAFTTQFVLKCSN GIKGITLYAEVDGKSLPAARLSSDNKYQVSWTEDIKKVHSGDYNIKLYDEERYAAIRKAL RNGEDSNNVKPLAVVVLNNPGIYRGPWINSELLAVLLAALVSYSAFSSKFKLLA |
 Top
| |