| Protein: 48097144 XP_393701.1 PREDICTED: probable signal peptidase complex subunit 2-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 57.4 | 42.6 | 1.3474178 | ||
| Scape | 39.8 | 25.8 | 34.4 | 1.1569767 | 0.75 |
| Brain | |||||
| Crop | 23.5 | 76.5 | 0.30718955 | ||
| Eye | |||||
| Intestine | 57.4 | 42.6 | 1.3474178 | ||
| Leg, front | 67.1* | 32.9 | 2.0395136 | ||
| Leg, middle | |||||
| Leg, rear | 58.7 | 41.3 | 1.4213076 | ||
| Mandibular gland | 7.6 | 92.4 | 0.08225108 | ||
| Rectum | |||||
| Salivary gland, cerebral | 65.8 | 34.2 | 1.9239767 | ||
| Salivary gland, thoracic | 43.8 | 22.2 | 34 | 1.2882353 | 0.65294117 |
| Sternite | 18.8 | 81.2 | 0.23152709 | ||
| Tergite | 9.4 | 49 | 41.5 | 0.22650602 | 1.1807228 |
| Ventriculus | 48.9 | 25.9 | 25.2 | 1.9404762 | 1.0277778 |
| Thoracic muscle | |||||
| Fat body | 18.5 | 27 | 54.5 | 0.33944955 | 0.49541286 |
| Malpighian tubules | 31.1 | 45.8 | 23.1 | 1.3463204 | 1.982684 |
| Nerve chord | 30.2 | 44.6 | 25.2 | 1.1984127 | 1.7698413 |
| Poison sac | |||||
| Sting | 41.8 | 58.2 | 0.7182131 | ||
| Heart | 14.2 | 53.1 | 32.7 | 0.43425077 | 1.6238532 |
| Hypopharyngeal gland | 6.9 | 93.1 | 0.07411385 | ||
| Galea | 25.7 | 25.3 | 48.9 | 0.52556235 | 0.5173824 |
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 35.8 | 34.5 | 48.1 | 0.7442827 | 0.7172557 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MGADKNTENLVIKINKWDGSAVKNALDDAVKDVLTKKYNYIENFALLDGRLALCGIAVTV AIVALLCDYLYPFPASKPVLAICVTLYFLLIGLLTLYTTYKEKGIFVVAIQRDPAGFNPD LIWEASSYLKRYDDKYNLVLSVRSTATGNVNETSVTKSVANFIDVNGVVIPELIENVVTN MHDSLTIQRKEK |
 Top
| |