| Protein: 328780773 XP_003249857.1 PREDICTED: slit homolog 2 protein-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 56.2 | 43.8 | 1.283105 | ||
| Scape | 46.7 | 17.9 | 35.4 | 1.3192091 | 0.50564975 |
| Brain | |||||
| Crop | 2.2* | 97.8 | 0.022494888 | ||
| Eye | |||||
| Intestine | |||||
| Leg, front | |||||
| Leg, middle | 35.1 | 37.6 | 27.3 | 1.2857143 | 1.3772894 |
| Leg, rear | 33 | 67 | 0.49253732 | ||
| Mandibular gland | 22.9 | 77.1 | 0.29701686 | ||
| Rectum | |||||
| Salivary gland, cerebral | 41.9 | 38.3 | 19.8 | 2.1161616 | 1.9343435 |
| Salivary gland, thoracic | |||||
| Sternite | 25.3 | 44.4 | 30.3 | 0.8349835 | 1.4653466 |
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 27.3 | 6.6* | 66.1 | 0.4130106 | 0.09984872 |
| Malpighian tubules | |||||
| Nerve chord | |||||
| Poison sac | |||||
| Sting | |||||
| Heart | 11.3 | 11.3* | 77.4 | 0.14599483 | 0.14599483 |
| Hypopharyngeal gland | |||||
| Galea | |||||
| Glossa | 18.5 | 44.8 | 36.6 | 0.5054645 | 1.2240437 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 28.7 | 29.2 | 52.6 | 0.54562736 | 0.5551331 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MIETPPRSILPLVLLLLLTVAQCQEQSLQCKQITGYKVCERKGTLVDVTQQEFEERLDIH DMNLLSIREGAFKNLSTTKLSLGLGNKISVVGRESFKGLDKLVRLDLDSNLVQLSPNLFS ELKQLNSLSLIFNKINDIPKDTFAGLSNLMWLYLGHNDIRSISKNSFTGLSSSLLFLWLN DNKISSVESGTFGQMPELTRLHLENNKLTSIQQGVLKGLHKLDGLFLEYNQLGRVSKTDF KGLIGLRILNLHHNQIDNIEEGAFSDLKQLEQLDLRKNRLSTIEARVFNGLTSLKKLDLS DNRIGVVQLAAFQDLPALKTLNLANNNLTSVDRKEFGLTSLTILYT |
 Top
| |