| Protein: 328787123 XP_395330.3 PREDICTED: dehydrogenase/reductase SDR family member 7-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | 43.7 | 56.3 | 0.7761989 | ||
| Brain | |||||
| Crop | 48.6 | 20.2 | 31.2 | 1.5576923 | 0.6474359 |
| Eye | |||||
| Intestine | 23.5 | 52.1 | 24.3 | 0.9670782 | 2.144033 |
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | |||||
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 43.6 | 20.2 | 36.2 | 1.2044199 | 0.55801105 |
| Malpighian tubules | 62.6* | 18.6 | 18.8 | 3.3297873 | 0.9893617 |
| Nerve chord | 22.3 | 59.2 | 18.6 | 1.1989248 | 3.1827958 |
| Poison sac | |||||
| Sting | |||||
| Heart | 25.5 | 47.4 | 27.1 | 0.9409594 | 1.7490774 |
| Hypopharyngeal gland | 95.1 | 4.9 | 19.408163 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 37.7 | 44.6 | 27.2 | 1.3860294 | 1.6397059 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MDLLTIIGMLITIYFLIYIILPWFLDCDFCLAFYEKFGKPINSLEGKVVWITGASSGIGE NLAYVLAKAGCKLILSSRTETKLEKVKTNCLQKNKNLKSSDIEVLVLDILDINKHELVFN SIIAKFGKLDILVNNAGRSQRAKWENIELSVDKELFDLNVFSTIALSRLVAKYFFQMNEG HFVINSSIAGVTAVPFSATYCASKSSLHAYFESLSIEKINKNISITIVCPGPVETNFLAE SFTEKSGEKYIVNQEEKPTHRMTAERCATLIGIAIANKLSVVWICKSIILQMVYLRIYYP NVGTWIIKQLGKNFLHYLRDNKSNIENKK |
 Top
| |