| Protein: 328782011 XP_624044.3 PREDICTED: ferritin subunit |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | 40.7 | 23.6 | 35.7 | 1.140056 | 0.66106445 |
| Brain | |||||
| Crop | |||||
| Eye | 78.7* | 21.3 | 3.6948357 | ||
| Intestine | |||||
| Leg, front | 16.5 | 51.5 | 32.1 | 0.5140187 | 1.6043614 |
| Leg, middle | 50.9 | 49.1 | 1.0366598 | ||
| Leg, rear | 47.8 | 14.4 | 37.8 | 1.2645502 | 0.3809524 |
| Mandibular gland | 34.5 | 65.5 | 0.52671754 | ||
| Rectum | |||||
| Salivary gland, cerebral | 92.4* | 4.2 | 3.4 | 27.17647 | 1.2352941 |
| Salivary gland, thoracic | 16* | 38.9 | 45.1 | 0.35476717 | 0.8625277 |
| Sternite | 16.7 | 32.7 | 50.5 | 0.33069307 | 0.6475248 |
| Tergite | 2.2 | 48.8 | 49 | 0.04489796 | 0.9959184 |
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 5.1 | 8.7* | 86.2 | 0.059164733 | 0.10092808 |
| Malpighian tubules | |||||
| Nerve chord | |||||
| Poison sac | 2 | 98 | 0.020408163 | ||
| Sting | 58 | 42 | 1.3809524 | ||
| Heart | 9.4 | 31.6 | 59 | 0.15932204 | 0.5355932 |
| Hypopharyngeal gland | 34.7 | 65.3 | 0.5313936 | ||
| Galea | 28.1 | 71.9 | 0.3908206 | ||
| Glossa | 14.5 | 45.5 | 40 | 0.3625 | 1.1375 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 28.8 | 33.8 | 50.1 | 0.5748503 | 0.6746507 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MKLLYVLFIVFVYINGSLGNDSATRSCIISNIAADENATKHWLDMDKNCIKSLESQVNVE IKAAMTYLAMGAHFALDVINRPGFSKFFFESATEEREHAIKVLEYLLMRGXLTNINEDNV LLRFPLVK |
 Top
| |