| Protein: 148224276 NP_001090623.1 triosephosphate isomerase |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 28.7 | 44.6 | 26.6 | 1.0789474 | 1.6766918 |
| Scape | 23.5 | 41.9 | 34.5 | 0.68115944 | 1.2144928 |
| Brain | 28.6 | 35 | 36.4 | 0.78571427 | 0.96153843 |
| Crop | 49.6 | 13.2 | 37.2 | 1.3333334 | 0.3548387 |
| Eye | 29.8 | 33 | 37.2 | 0.8010753 | 0.88709676 |
| Intestine | 31.9 | 36.7 | 31.3 | 1.0191693 | 1.172524 |
| Leg, front | 32.5 | 31.8 | 35.7 | 0.91036415 | 0.8907563 |
| Leg, middle | 30.4 | 31.3 | 38.3 | 0.79373366 | 0.8172324 |
| Leg, rear | 24 | 33.2 | 42.8 | 0.5607477 | 0.7757009 |
| Mandibular gland | 8.5 | 58.6 | 32.9 | 0.25835866 | 1.781155 |
| Rectum | 23 | 46.7 | 30.3 | 0.7590759 | 1.5412542 |
| Salivary gland, cerebral | 22 | 42.1 | 35.9 | 0.61281335 | 1.172702 |
| Salivary gland, thoracic | 46.5 | 20.8 | 32.7 | 1.4220183 | 0.6360856 |
| Sternite | 40.1 | 35.5 | 24.4 | 1.6434426 | 1.454918 |
| Tergite | 34.9 | 36.4 | 28.6 | 1.2202797 | 1.2727273 |
| Ventriculus | 16.6 | 39.9 | 43.5 | 0.3816092 | 0.9172414 |
| Thoracic muscle | 34.3 | 56.4 | 9.4 | 3.6489363 | 6 |
| Fat body | 52.8 | 33.7 | 13.5 | 3.911111 | 2.4962964 |
| Malpighian tubules | 35.7 | 34.7 | 29.5 | 1.2101694 | 1.1762712 |
| Nerve chord | 26.2 | 44.2 | 29.6 | 0.8851351 | 1.4932432 |
| Poison sac | |||||
| Sting | 44.7 | 55.3 | 0.80831826 | ||
| Heart | 51.3 | 26.8 | 21.9 | 2.3424656 | 1.2237443 |
| Hypopharyngeal gland | 48.7 | 51.3 | 0.94931775 | ||
| Galea | 15.8 | 45.5 | 38.7 | 0.40826872 | 1.1757106 |
| Glossa | 23.4 | 37.3 | 39.2 | 0.5969388 | 0.95153064 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 30.9 | 38.1 | 33.5 | 0.9223881 | 1.1373135 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MGRKFFVGGNWKMNGTKSEINDIVGFLKKGPLDSNVEVVVGVPSIYLTYAKNILPNNISI AGQNTYKVAKGAFTGEISPAMLLDNGIPWVILGHSERRNIFGENDELIAEKVAHALESGL KVIACIGEKLEEREAGKTDEVVFRQTKAIANKINSWDNVVVAYEPVWAIGTGKTATPQQA QEVHEKLRNWFSKNVNQTVAETVRIIYGGSVTAGNAKDLAKEKDIDGFLVGGASLKPDFV QIVNAKQ |
 Top
| |