| Protein: 328780929 XP_003249883.1 PREDICTED: hypothetical protein LOC725439 isoform 1 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 69.3* | 10.6 | 20.1 | 3.4477613 | 0.5273632 |
| Scape | 72.7* | 4.4 | 22.9 | 3.1746726 | 0.19213974 |
| Brain | 48.2 | 51.8 | 0.93050194 | ||
| Crop | |||||
| Eye | |||||
| Intestine | 13.2 | 45.2 | 41.6 | 0.31730768 | 1.0865384 |
| Leg, front | 43.9 | 56.1 | 0.7825312 | ||
| Leg, middle | 45.6 | 26.9 | 27.5 | 1.6581818 | 0.97818184 |
| Leg, rear | 66.8 | 15.5 | 17.7 | 3.7740114 | 0.8757062 |
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 27.7 | 33.8 | 38.5 | 0.7194805 | 0.87792206 |
| Sternite | |||||
| Tergite | |||||
| Ventriculus | 2* | 98 | 0.020408163 | ||
| Thoracic muscle | |||||
| Fat body | 28.2 | 33.7 | 38.1 | 0.7401575 | 0.88451445 |
| Malpighian tubules | 16.1 | 61.1* | 22.8 | 0.70614034 | 2.6798246 |
| Nerve chord | 30 | 40.2 | 29.8 | 1.0067114 | 1.3489933 |
| Poison sac | |||||
| Sting | 5.8* | 94.2 | 0.061571125 | ||
| Heart | 19.2 | 46.4 | 34.4 | 0.55813956 | 1.3488373 |
| Hypopharyngeal gland | |||||
| Galea | |||||
| Glossa | 17.8 | 5.8* | 76.5 | 0.23267974 | 0.075817 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 37 | 28.2 | 44.7 | 0.8277405 | 0.6308725 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MSPSIESFPIQKLDTLLAQTLGNNIQIKHVEWKLLNAPGENYGSDMLAITVIVTRSPKNT EETLNLVAKLPPTSVFLLDLFNSPISFKKEIQFYNSMAKEFMKLQIENGMNDQELVPKFY GGRLGLKPDKFDGQAVILLENLKCNGYVTEDRIFGLDKKHTEFAVKRLAKMHALVIALKL KKPQLYKNIVTELLINVANETTEKCVNDMMQKVIIDLQNMEEIKPFIDNIKKTIEYCKEQ IEKSEKIEEPWGTMIHNDFWVNNMLFKHDEQGEIIDMKIVDFQLNVYDYGVKDLIFFLIS SANKDTLDNELDYMLDLYYSSFIKDLKALNIDIDKFPKKKFDEIVNYCGTLKLNQCFLMT QVIQAPRINKNLDTKITNFDTEMKADEIFKDQSNNVIYKEKLSHIATVFHKKGWLLK |
 Top
| |