| Protein: 328787740 XP_394987.4 PREDICTED: 60S ribosomal protein L44 isoform 2 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | 44.2 | 26 | 29.8 | 1.4832215 | 0.8724832 |
| Brain | |||||
| Crop | 6.2* | 93.8 | 0.06609808 | ||
| Eye | |||||
| Intestine | 56.7 | 43.3 | 1.3094689 | ||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 25 | 75 | 0.33333334 | ||
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 46.9 | 24.5 | 28.7 | 1.6341463 | 0.85365856 |
| Malpighian tubules | 44 | 56 | 0.78571427 | ||
| Nerve chord | 21.9 | 78.1 | 0.28040972 | ||
| Poison sac | |||||
| Sting | 52.4 | 47.6 | 1.1008403 | ||
| Heart | 29.1 | 39.9 | 31 | 0.9387097 | 1.2870967 |
| Hypopharyngeal gland | 5.6 | 94.4 | 0.059322033 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 31.6 | 32.9 | 57.8 | 0.5467128 | 0.56920415 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MVNVPKQRRTFCKKCKVHKPHKVTQYKKSKERHASQGRRRYDRKQQGFGGQTKPIFRKKA KTTKKIVLRMECTECKYRKQIPLKRCKHFELGGDKKRKGQMIQF |
 Top
| |