| Protein: 328792166 XP_623555.2 PREDICTED: nascent polypeptide-associated complex subunit alpha-like isoform 1 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | 36.7 | 41.3 | 22 | 1.6681818 | 1.8772727 |
| Brain | |||||
| Crop | 44.6 | 55.4 | 0.8050541 | ||
| Eye | |||||
| Intestine | 19.4 | 58.5 | 22.2 | 0.8738739 | 2.6351352 |
| Leg, front | |||||
| Leg, middle | 56* | 18.4 | 25.6 | 2.1875 | 0.71875 |
| Leg, rear | 59.9 | 40.1 | 1.4937656 | ||
| Mandibular gland | 5.2 | 94.8 | 0.05485232 | ||
| Rectum | |||||
| Salivary gland, cerebral | 41.2 | 13.3 | 45.5 | 0.9054945 | 0.2923077 |
| Salivary gland, thoracic | 44.2 | 21.9 | 33.9 | 1.3038348 | 0.6460177 |
| Sternite | 7.6* | 3.3* | 89.1 | 0.08529742 | 0.037037037 |
| Tergite | 82.9 | 17.1 | 4.8479533 | ||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 50.2 | 26.5 | 23.4 | 2.1452992 | 1.1324786 |
| Malpighian tubules | 22.5* | 27.6 | 49.9 | 0.4509018 | 0.5531062 |
| Nerve chord | 38.8 | 29.1 | 32.1 | 1.2087227 | 0.90654206 |
| Poison sac | |||||
| Sting | 53 | 47 | 1.1276596 | ||
| Heart | 12.6 | 41.8 | 45.5 | 0.2769231 | 0.9186813 |
| Hypopharyngeal gland | 15.2 | 84.8 | 0.17924528 | ||
| Galea | |||||
| Glossa | 6.1* | 93.9 | 0.06496272 | ||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 34.8 | 30.7 | 48.4 | 0.71900827 | 0.63429755 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MILKKREYIETSNKHIFLCKSSCVSRNMPELTELDKAASSEPTKVEAAATGSGTDTDSDD TIPELDDAGAGGTVGFPGTTVTGLPIDMVSKAKQSRGEKKARKLMSKLGLKPVQGVNRVT IRKSKNILFVINKPDVLKNPASDTYIVFGEAKIEDLSQQAQVAAAEKFKEPPVIPATEAG GSTTVVAPIQEESEEEVDETGVEEKDIDLVMCQANVSRGKAIKALKNNQNDIVNAIMELT M |
 Top
| |