| Protein: 328789160 XP_001121552.2 PREDICTED: hypothetical protein LOC725740 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | 40.6 | 17.8 | 41.7 | 0.97362113 | 0.4268585 |
| Brain | 49 | 51 | 0.9607843 | ||
| Crop | |||||
| Eye | |||||
| Intestine | |||||
| Leg, front | 40.5 | 59.5 | 0.6806723 | ||
| Leg, middle | 75 | 25 | 3 | ||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | 14.2 | 3.9 | 81.9 | 0.17338218 | 0.04761905 |
| Salivary gland, thoracic | 28.4 | 38 | 33.6 | 0.8452381 | 1.1309524 |
| Sternite | 12.1 | 87.9 | 0.13765644 | ||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | 24.6 | 6.8* | 68.6 | 0.3586006 | 0.09912536 |
| Fat body | |||||
| Malpighian tubules | |||||
| Nerve chord | 25.2 | 39.7 | 35.1 | 0.71794873 | 1.1310542 |
| Poison sac | |||||
| Sting | |||||
| Heart | 50.3 | 12.3 | 37.4 | 1.3449198 | 0.328877 |
| Hypopharyngeal gland | |||||
| Galea | |||||
| Glossa | 4.7* | 95.3 | 0.049317945 | ||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 27.9 | 28.8 | 56.1 | 0.4973262 | 0.51336896 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MSFYLRSIPNKFTSFVNIRRQITDINYRLPKNVKSLFLEEFLDAQTNSTNFKEKPLNSMA YLSRQNVLFSSFNNIKSSKALNKKHNWTKQQMIKLYHQKQNNIQIQNVTNSYLTYTSVLK MDTQWEISPEHLKNKYNVPFREMVPAKRIFNNDVLFKYEKDKTFYAEISPNVKNVNEMQT SEDRKSFETQLQSVFDVLRNDLPLLFVQSMNYSIYTKDLIFINNIKGTTTVGIEQYLKQI ALLRLVGHLKFAYVKLKILKMTMHPEDNSIKVRWRIVGASGTRVFLTFWKIKIFNTREQV ENKSAWYDGFSTFYLNNEGKIFKHVVDKTMPDQNIEEKIKMPIEAKLALFIALLDSNFVR FWLKQYPEFLQIK |
 Top
| |