| Protein: 328780485 XP_624404.2 PREDICTED: hypothetical protein LOC552020 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 58.4* | 15.9 | 25.7 | 2.2723734 | 0.618677 |
| Scape | 33.4 | 18.1 | 48.5 | 0.6886598 | 0.3731959 |
| Brain | 48.4 | 16.1 | 35.4 | 1.3672316 | 0.45480227 |
| Crop | 69.8* | 10.7 | 19.5 | 3.579487 | 0.548718 |
| Eye | |||||
| Intestine | 19.3 | 50.1 | 30.7 | 0.6286645 | 1.6319218 |
| Leg, front | 23.9 | 40.1 | 36 | 0.6638889 | 1.1138889 |
| Leg, middle | 27 | 39.4 | 33.5 | 0.80597013 | 1.1761194 |
| Leg, rear | 41.1 | 35.9 | 22.9 | 1.7947599 | 1.5676856 |
| Mandibular gland | 2.4 | 65.4 | 32.2 | 0.07453416 | 2.031056 |
| Rectum | 2.4 | 83.1* | 14.5 | 0.16551724 | 5.7310343 |
| Salivary gland, cerebral | 87.4 | 12.6 | 6.9365077 | ||
| Salivary gland, thoracic | 63.8 | 3.4* | 32.8 | 1.945122 | 0.10365853 |
| Sternite | 65.1 | 34.9 | 1.8653295 | ||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 8.6 | 46.8 | 44.5 | 0.19325842 | 1.0516855 |
| Malpighian tubules | 15 | 74.6* | 10.4 | 1.4423077 | 7.173077 |
| Nerve chord | 27.8 | 28.3 | 43.8 | 0.6347032 | 0.6461187 |
| Poison sac | |||||
| Sting | |||||
| Heart | 60 | 40 | 1.5 | ||
| Hypopharyngeal gland | 66.8 | 33.2 | 2.0120482 | ||
| Galea | 67.3 | 32.7 | 2.058104 | ||
| Glossa | 34.5 | 47.5 | 18 | 1.9166666 | 2.6388888 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 37.1 | 42.6 | 30.1 | 1.2325581 | 1.4152824 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MGCNTSKESVQPVGDEAKEDGKNGDITKGESSPAKVDSQESSQKRQSAADSKKEAESKGG EKKEEEEKTEREKAATRIQAAFRGHHARKSMKDIESSTKQTGTKSSSEPTKEQLQQEFRA DDKELCEAATKIQASFRGHMSRKEQAAAAIAKSAENAVEDVVSKMEEKAKDAMNELEGID LTDPDLHKAATKIQASFRGHKVRQEVLGNPAQTEQTKK |
 Top
| |