| Protein: 66547891 XP_623834.1 PREDICTED: actin-like protein 87C-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 19.6* | 80.4 | 0.24378109 | ||
| Scape | 41 | 17.1 | 42 | 0.97619045 | 0.40714285 |
| Brain | |||||
| Crop | |||||
| Eye | |||||
| Intestine | 27.4 | 34 | 38.7 | 0.7080103 | 0.878553 |
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 22.4 | 47.3 | 30.3 | 0.7392739 | 1.5610561 |
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 56.6 | 25.1 | 18.3 | 3.0928962 | 1.3715847 |
| Malpighian tubules | 39.1 | 21.1 | 39.9 | 0.9799499 | 0.52882206 |
| Nerve chord | 43.2 | 14.1 | 42.6 | 1.0140845 | 0.3309859 |
| Poison sac | |||||
| Sting | |||||
| Heart | 30.2 | 28 | 41.8 | 0.72248805 | 0.6698565 |
| Hypopharyngeal gland | 40.2 | 59.8 | 0.6722408 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 34.9 | 28.4 | 43.7 | 0.798627 | 0.6498856 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MEPYDVIINQPVVIDNGSGVIKAGFAGDQIPKCRFPNYIGRPKHIRVMAGALEGDLFVGP IAEEHRGLLSLRYPMEHGVVTDWNDMERIWSYVYSKDQLATFSEEHPVLLTEAPLNPRKN REKAAEIFFDTFNVPALFVSMQAVLSLYATGRTTGVVLDAGDGVTHAVPIYEGFAMPHSI MRVDIAGRDVTRHLRLLLRKEGINFRTTAEFEIVRTIKERACYLASNPQKEETIETEKFQ YILPDGSYLEIGPARFRAPEVLFRPDLIGEECEGLHEVLTYSIQKSDLDLRKVLFQNIVL SGGSTLFRGFGDRLLSEIRKMAPKDIKIRISAPQERLYSTWIGGSILASLDTFKKMWVSK REYEEDGIRAIHRKTF |
 Top
| |