![]() |
||||||
| Home | List proteins by tissue | Protein search | Downloads | Links | ||
| Protein: 328778137 XP_623697.2 PREDICTED: LOW QUALITY PROTEIN: t-complex protein 1 subunit zeta |
Distribution (mouse over here![]() Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 30.3* | 69.7 | 0.43472022 | ||
| Scape | 32.4 | 29.1 | 38.5 | 0.84155846 | 0.7558442 |
| Brain | 35 | 65 | 0.53846157 | ||
| Crop | 33.9 | 31.7 | 34.4 | 0.9854651 | 0.92151165 |
| Eye | |||||
| Intestine | 21.8 | 40 | 38.2 | 0.5706806 | 1.0471205 |
| Leg, front | 42 | 58 | 0.7241379 | ||
| Leg, middle | 37.4 | 14.4* | 48.2 | 0.7759336 | 0.2987552 |
| Leg, rear | 62.6 | 37.4 | 1.6737968 | ||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | 77.8 | 2.9 | 19.3 | 4.031088 | 0.15025906 |
| Salivary gland, thoracic | 22.2 | 49.7 | 28.2 | 0.78723407 | 1.7624114 |
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 38.4 | 27.7 | 33.9 | 1.1327434 | 0.81710917 |
| Malpighian tubules | 31.6 | 29.2 | 39.1 | 0.80818415 | 0.74680305 |
| Nerve chord | 33.5 | 19 | 47.5 | 0.70526314 | 0.4 |
| Poison sac | |||||
| Sting | 64.8 | 35.2 | 1.8409091 | ||
| Heart | 25.9 | 31.3 | 42.8 | 0.6051402 | 0.7313084 |
| Hypopharyngeal gland | 33.4 | 66.6 | 0.5015015 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 37.7 | 31.4 | 43.9 | 0.85876995 | 0.71526194 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MAAISLLNPKAEFARAAQALAVNISAAKGIQDVMKTNLGPKGTMKMLVSGAGDIKITKDG NVLLHEMQIQHPTASLIAKASTAQDDVTGDGTTSTVLIIAELLKQADIYISEGLHPRVLT EGFELARIKTLEVLDSLKIPIEPSKENLMNVARTSLRTKIHPSIADKLTEICVDAVLAIR QKDQEIDLHMIELMEMQHRTAADTSLILGIVTDHGSRHPDMPKRVENAYILTCNVSLEYE KSEVNSGFFYKTAEEREKLVAAEREFIDNRVKKIIELKKKLCDGTDKSFVVINQKGIDPP SLDMLARENILALRRAKRRNMERLALACGGTAMNSFDDIKEEHLGWAGXVYEHGETKYTF IEECKKPNSVTILLKGPNKYTLEQLKDAVRDGLRAIKNAIDDCAVIPGAGAFEVAASQTL HQYKEKVKGKQRLGVQAYAEAILIIPKTLAVNSGFDAQDTIVKLLEERSTLGEAVGLDIS TDEALKPTDAGIYDNYNVKKQIINSCTIIASNLLLVDEIMRAGLSSLKG |
|
| |