| Protein: 328778400 XP_624824.3 PREDICTED: ADP-ribosylation factor-like protein 8B-A-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 48.9 | 51.1 | 0.95694715 | ||
| Scape | 54.5 | 45.5 | 1.1978022 | ||
| Brain | |||||
| Crop | 12.7 | 69.8* | 17.4 | 0.72988504 | 4.011494 |
| Eye | |||||
| Intestine | 52.3 | 47.7 | 1.096436 | ||
| Leg, front | |||||
| Leg, middle | 75.8* | 24.2 | 3.1322315 | ||
| Leg, rear | |||||
| Mandibular gland | 35.3 | 64.7 | 0.54559505 | ||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 35.5 | 32.6 | 31.8 | 1.1163522 | 1.0251572 |
| Sternite | 56.5 | 43.5 | 1.2988505 | ||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 53.3 | 13.2 | 33.4 | 1.5958084 | 0.39520958 |
| Malpighian tubules | |||||
| Nerve chord | 14.4 | 63.2 | 22.4 | 0.64285713 | 2.8214285 |
| Poison sac | |||||
| Sting | |||||
| Heart | 6.6 | 51.8 | 41.6 | 0.15865384 | 1.2451923 |
| Hypopharyngeal gland | 68.5 | 31.5 | 2.1746032 | ||
| Galea | 64.4 | 35.6 | 1.8089888 | ||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 40.4 | 50.7 | 37.7 | 1.0716181 | 1.3448275 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MLALINRILDWFKSLFWKEEMELTLVGLQYSGKTTFVNVIASGQFSEDMIPTVGFNMRKI TKGNVTIKVWDIGGQPRFRSMWERYCRGVNAIVYMVDAADSEKIEASRNELHNLLDKPQL SGIPVLVLGNKRDLPHALDENGLIERMNLSAIQDREICCYSISCKEKDNIDITLQWLIAH SRSGVR |
 Top
| |