| Protein: 66514595 XP_623213.1 PREDICTED: ras-related protein Rab-3 isoform 2 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | 15.2 | 84.8 | 0.17924528 | ||
| Brain | 34.7 | 65.3 | 0.5313936 | ||
| Crop | |||||
| Eye | |||||
| Intestine | |||||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 93.8* | 2 | 4.2 | 22.333334 | 0.47619048 |
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | |||||
| Malpighian tubules | |||||
| Nerve chord | 9.2* | 45.9 | 44.9 | 0.20489977 | 1.0222718 |
| Poison sac | |||||
| Sting | |||||
| Heart | |||||
| Hypopharyngeal gland | 17.6 | 82.4 | 0.21359223 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 23.1 | 56.3 | 0.41030195 | ||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MSKGFESRAENSIKDTRPPVKDSVLELRTRMARMMSIVDITPRDRRLMAGQDPKFQKEAA DQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTVFRHDKRVKLQI WDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNSVQDWVTQIKTYSCDNAQVILVGN KCDMEDERVITTERGKQLADQLGVQFFETSAKENINIKTVFEQLVDIICDKMSESLDNDP TLIAGGMGQAKGQRLTDQPTNPTDDNCNC |
 Top
| |