| Protein: 328777906 XP_393447.2 PREDICTED: hypothetical protein LOC409956 isoform 1 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 26 | 41.2 | 32.7 | 0.795107 | 1.2599388 |
| Scape | 47.7 | 17.6 | 34.8 | 1.3706896 | 0.50574714 |
| Brain | 35.5 | 27.5 | 36.9 | 0.9620596 | 0.74525744 |
| Crop | 56.8 | 43.2 | 1.3148148 | ||
| Eye | |||||
| Intestine | 60.9 | 39.1 | 1.5575447 | ||
| Leg, front | 42.6 | 57.4 | 0.74216026 | ||
| Leg, middle | 61.3 | 38.7 | 1.5839794 | ||
| Leg, rear | 19.9 | 80.1 | 0.24843945 | ||
| Mandibular gland | 13.6 | 86.4 | 0.1574074 | ||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 40.9 | 16.9 | 42.2 | 0.9691943 | 0.40047392 |
| Sternite | 46.1 | 27.4 | 26.5 | 1.7396226 | 1.0339622 |
| Tergite | 91.4 | 8.6 | 10.627907 | ||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 54.5 | 45.5 | 1.1978022 | ||
| Malpighian tubules | 24.4 | 51 | 24.7 | 0.98785424 | 2.0647774 |
| Nerve chord | 37 | 39.4 | 23.6 | 1.5677966 | 1.6694915 |
| Poison sac | |||||
| Sting | 56.2 | 43.8 | 1.283105 | ||
| Heart | |||||
| Hypopharyngeal gland | |||||
| Galea | 63.4 | 36.6 | 1.7322404 | ||
| Glossa | 73.9 | 26.1 | 2.8314176 | ||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 38.2 | 46 | 40.4 | 0.94554454 | 1.1386138 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MLSYMLPTEDKPPPGDSNQGNYRANKLQRSPKERASAVAKPVGGKVITISPKKYVDSSSK MIVSTKIEERDGDDQRHLQDEQRQQHQGVLSESPKHNGTVVKKSTLHTSKVTKDDSLYSI NSDASTVGSDRKSKIFNGAKHTSLKRVSFGSSKGSMVETLVYETPVQEEPEINRFMDHNG RIPSMITSVPDTDEGREMVRVSLLGPQPSPTTPGVFQVQPIAISRTQPIDMDTVPAELLT THTEHTAPAYHTQISTDSGWDNPFRPDGDLSREADEIVELIKGGKPITPTPGQTAPPLPG CDTTDNAQTTVDHDSSSSPLLKSSANSTNRHANSSPKPGQENGNAHGTPMKAATANSQQP VNDKVVTSSRAATVEVARMTAQGPGDASQVEHVTLKKKPKCKCCLLQ |
 Top
| |