| Protein: 328778038 XP_393333.3 PREDICTED: eukaryotic translation initiation factor 3 subunit M |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | 8.1 | 91.9 | 0.08813928 | ||
| Brain | |||||
| Crop | |||||
| Eye | |||||
| Intestine | |||||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 31.7 | 31.7 | 36.6 | 0.8661202 | 0.8661202 |
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | 2.6* | 97.4 | 0.026694044 | ||
| Fat body | 29 | 34.4 | 36.6 | 0.79234976 | 0.9398907 |
| Malpighian tubules | 55.6 | 44.4 | 1.2522522 | ||
| Nerve chord | 21.5 | 78.5 | 0.27388534 | ||
| Poison sac | |||||
| Sting | |||||
| Heart | 15.2 | 42.3 | 42.5 | 0.35764706 | 0.9952941 |
| Hypopharyngeal gland | 14.8 | 85.2 | 0.17370892 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 24.3 | 27.1 | 64.1 | 0.37909517 | 0.4227769 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MQVPPIFMELPLEDQAQELRIYFKNLGAEISEEKSPKGIEDDLHKIIGVCEACFKEGNES EIETVLNDIVSIMIVIPTERAENLILAFCEKLTKAPGYKLGLVCLKALWLLFQSLPDDSP MRYHVYYHLVQIARNVDQVKAVYGGIDQLKQQFASLPPSNEQMQKLLRLLHEVLLSCKQG EQAAAVMVELLGTYTAENASAAREDAQRCILAALVDPNTFLLDPLLALKPVRFLEGELIH DLLLVFVQDKLPAYLHFYQHHKEFVEHQLGLNHEQNMKKMRLLTFMQLAETNPEMSFDTI QEELQINEDEVESFIIDVLKTKLVRARMDQAGRKVLISSTMHRTFGKPQWMQLRDLLAAW KANLTAVQEEVVKLFLYYLLI |
 Top
| |