| Protein: 328792645 XP_001121303.2 PREDICTED: hemicentin-1-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | 36.1 | 63.9 | 0.5649452 | ||
| Brain | |||||
| Crop | |||||
| Eye | |||||
| Intestine | |||||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | 67.4 | 32.6 | 2.0674846 | ||
| Salivary gland, thoracic | |||||
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 25.8 | 74.2 | 0.34770888 | ||
| Malpighian tubules | |||||
| Nerve chord | 48.6 | 51.4 | 0.9455253 | ||
| Poison sac | |||||
| Sting | |||||
| Heart | 3.1 | 15.5* | 81.5 | 0.03803681 | 0.19018404 |
| Hypopharyngeal gland | |||||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 31.5 | 60.7 | 0.51894563 | ||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MRDRLSWYMVFLILPTILLARSLDKDRRVPYSIPADWKALWFSNLDDLQRVNDANDNNTV SNVTVQLGGTAFLHCKVRNLADRTVSDAEISWIRRRDFHVLTSSTFTYTNDERFQVLHPE GSDDWTLQIKYVQDRDNGTYECQVSRSTGILSHFVNLNIVIPEAFILGSGEHHVDVGSII NLVCIIEKSPTPPQYVFWYHNNRMINYDTTRGSSVTVQTDSSSTQSRLTIHQAVESDTGN YTCSASNTKPASIYVFVTEGDKMAAIQRRKTSAAKKNFCELLVLIVTIAIEVVLTR |
 Top
| |