| Protein: 328779671 XP_393575.4 PREDICTED: protein lethal(2)essential for life-like isoform 1 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 17.6 | 68.4* | 14 | 1.2571429 | 4.885714 |
| Scape | 39.8 | 33.7 | 26.5 | 1.5018868 | 1.2716981 |
| Brain | |||||
| Crop | 5.3* | 64.5 | 30.2 | 0.17549668 | 2.1357615 |
| Eye | |||||
| Intestine | |||||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 8.5 | 67.9 | 23.6 | 0.3601695 | 2.8771186 |
| Sternite | |||||
| Tergite | 70.2 | 29.8 | 2.3557048 | ||
| Ventriculus | |||||
| Thoracic muscle | 10.4 | 89.6 | 0.11607143 | ||
| Fat body | 90.5* | 9.5 | 9.526316 | ||
| Malpighian tubules | 71* | 2.7* | 26.3 | 2.6996198 | 0.10266159 |
| Nerve chord | 47.8 | 52.2 | 0.91570884 | ||
| Poison sac | |||||
| Sting | 44.2 | 55.8 | 0.7921147 | ||
| Heart | |||||
| Hypopharyngeal gland | 48.4 | 51.6 | 0.93798447 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 25.4 | 53.8 | 37.2 | 0.6827957 | 1.4462366 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MRRGMTLIPRLFSHWWEALEQPHRLLDQHFGRGLRADQLFPSIPFRSFPYNFSRPWIDWE REEDCGWSIMRNDKDKFRVILDVQQFKPEEINVKVIDNFIVVEGKHEDKADDHGLISRHF VRKYLVPDQCDPEKAASSLSTDGILTITAPLRPEAAESKREKTIKIEQTGKPMVEDEPEK IKQTQ |
 Top
| |