| Protein: 328776270 XP_623380.2 PREDICTED: coatomer subunit zeta-1 isoform 1 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | 35.6 | 64.4 | 0.55279505 | ||
| Brain | |||||
| Crop | |||||
| Eye | |||||
| Intestine | |||||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 52.8 | 3.6* | 43.6 | 1.2110091 | 0.08256881 |
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 59.8 | 40.2 | 1.4875622 | ||
| Malpighian tubules | 59.1 | 40.9 | 1.4449878 | ||
| Nerve chord | |||||
| Poison sac | |||||
| Sting | |||||
| Heart | 63.9 | 36.1 | 1.7700831 | ||
| Hypopharyngeal gland | |||||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 44.4 | 45 | 0.9866667 | ||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MDGQLLEPTLYTVKGMAILDNDGNRILAKYYDKNIFPTSKEQKTFEKNLFNKTHRANAEI IMLDGLTCVYRSNVDLYFYVMGSSHENELILMSVLNCLYDSVSQILRKNVEKKAVLDSLD IVMLAMDEICDGGIILDADATSVVQRVALRTDDIPLGEQTVAQVLQSAKEQLKWSLLK |
 Top
| |