| Protein: 66512146 XP_396269.2 PREDICTED: syntaxin-12 isoform 1 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 33.6 | 34.3 | 32.1 | 1.046729 | 1.0685358 |
| Scape | 60.3 | 39.7 | 1.5188917 | ||
| Brain | |||||
| Crop | |||||
| Eye | |||||
| Intestine | 43.7 | 56.3 | 0.7761989 | ||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | 12 | 88 | 0.13636364 | ||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 44.5 | 21.5 | 34 | 1.3088236 | 0.63235295 |
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 31.1 | 18.9 | 49.9 | 0.6232465 | 0.3787575 |
| Malpighian tubules | 66.7 | 33.3 | 2.0030031 | ||
| Nerve chord | 41.2 | 18.7 | 40.1 | 1.0274314 | 0.46633416 |
| Poison sac | |||||
| Sting | |||||
| Heart | 47 | 27.8 | 25.2 | 1.8650794 | 1.1031746 |
| Hypopharyngeal gland | 55.5 | 44.5 | 1.247191 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 34.9 | 38.6 | 44.3 | 0.7878104 | 0.8713318 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MDIGFSSYHNGGPTREQDFGRLSQTIGTSILKISQNVSSMQKMVNQLGSSTDSQELRNQL HQIQHYTQQLAKDTSVHLRDLAILSNNSGSTSPGEQRQRKMQRERLQDEFTSALNSFQAV QRLAASKEKEMVRRAKASAGITPFGEKKQETLIELQDSRTQKQIQQQQLQEEQNLRMLEE QEASIRQLENNISDINQIFKDLGTIVYNQGEVIDSIEASVERTEVSVNEATSHVRQASIY QNKLRKKKCILVLIGVIVLFILIGIIAWQSS |
 Top
| |