| Protein: 328792982 XP_001120518.2 PREDICTED: endocuticle structural glycoprotein SgAbd-1-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 19.3* | 80.7 | 0.23915738 | ||
| Scape | 54.2 | 19.8 | 26 | 2.0846155 | 0.76153845 |
| Brain | |||||
| Crop | |||||
| Eye | |||||
| Intestine | |||||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | 68.9 | 14.4 | 16.7 | 4.1257486 | 0.8622754 |
| Rectum | |||||
| Salivary gland, cerebral | 44.7 | 55.3 | 0.80831826 | ||
| Salivary gland, thoracic | 96.7* | 3.3 | 29.30303 | ||
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | |||||
| Malpighian tubules | |||||
| Nerve chord | |||||
| Poison sac | |||||
| Sting | |||||
| Heart | |||||
| Hypopharyngeal gland | |||||
| Galea | 62.3 | 12.1 | 25.6 | 2.4335938 | 0.47265625 |
| Glossa | 57.4* | 32.6 | 9.9 | 5.79798 | 3.2929294 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 59.8 | 24.7 | 31.1 | 1.9228296 | 0.7942122 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MKILIFLGFATMVCAQYNRYPYNPDYYGRRFAILRQTQNSSPDGSYSYSYDTENGISVAE QGTPKFIGPNQIESVRGQFSYTAPDGTPILLTYTADENGFLPNGAHLPTPPPIPVAIQRA LAHNAAHPEEEEPYRRY |
 Top
| |