![]() |
||||||
| Home | List proteins by tissue | Protein search | Downloads | Links | ||
| Protein: 328779076 XP_392094.3 PREDICTED: putative mitochondrial inner membrane protein-like |
Distribution (mouse over here![]() Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 29.1 | 23.4 | 47.5 | 0.61263156 | 0.49263158 |
| Scape | 34.5 | 19.6 | 45.9 | 0.751634 | 0.42701524 |
| Brain | |||||
| Crop | 30.6 | 31.2 | 38.2 | 0.80104715 | 0.8167539 |
| Eye | |||||
| Intestine | 28 | 24.9 | 47.1 | 0.59447986 | 0.52866244 |
| Leg, front | 34.4 | 21.6 | 44 | 0.7818182 | 0.4909091 |
| Leg, middle | 41.6 | 19.2 | 39.2 | 1.0612245 | 0.48979592 |
| Leg, rear | 24.1 | 26.4 | 49.5 | 0.48686868 | 0.53333336 |
| Mandibular gland | 51.9 | 48.1 | 1.079002 | ||
| Rectum | 63.4 | 36.6 | 1.7322404 | ||
| Salivary gland, cerebral | 20.1 | 10 | 69.9 | 0.28755364 | 0.14306152 |
| Salivary gland, thoracic | 30.6 | 38.1 | 31.3 | 0.9776358 | 1.2172524 |
| Sternite | 63.4 | 36.6 | 1.7322404 | ||
| Tergite | 64.7 | 35.3 | 1.8328612 | ||
| Ventriculus | |||||
| Thoracic muscle | 40 | 45.8 | 14.2 | 2.8169014 | 3.225352 |
| Fat body | 39.9 | 28.9 | 31.2 | 1.2788461 | 0.92628205 |
| Malpighian tubules | 32.9 | 39.8 | 27.3 | 1.2051282 | 1.4578755 |
| Nerve chord | 28.8 | 33.5 | 37.7 | 0.76392573 | 0.88859415 |
| Poison sac | |||||
| Sting | 51 | 49 | 1.0408163 | ||
| Heart | 41 | 25.4 | 33.6 | 1.2202381 | 0.75595236 |
| Hypopharyngeal gland | 66.3 | 33.7 | 1.9673591 | ||
| Galea | 3.4* | 96.6 | 0.035196688 | ||
| Glossa | 35.6 | 22.1 | 42.3 | 0.8416076 | 0.5224586 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 35.5 | 32.8 | 42.5 | 0.8352941 | 0.7717647 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MFRIGLKFPCNGLNRVRKVKKNGSSRLYLTTRYYETRARTKYDQECRFSKDVKLISRIPV HKYSTDTPKREKSRGTTKTLLTLTAVAIGASGVLLYAKHDPKFRANLEGWIPGTDKTIQI IFQEESSYFEFIRTFFETLKQTIISSLFGGESKQTGQKRIDCTQVEDYIPPKPTFVPLID KKEPPINEPYAEIRISKEKGEEIEIVAEKPAPPPKDVPEELMPANLVELETSCGEAASKA IAAYQKAICVIQDYNKDVMRVVESLHATVGSAIWNRLKESTDKKKEAVKEAEDLANEAME SLNKIYNLIKDPKFDAPSHMKTAARRNIKKIMDDVDEAKKKYQTEIECGNMAERYWKQVK MARENLNEELQILFPNINIHEKKITLDENTFDLFVLHMYNKVSNLQRELEKTRTINESRI RAALKATGETMTEERLHTLVCLELDKEKQIYESEFSQKLLEEQKKFDDELRRQLKLQEQV HADHLQETITLKEEEAERNLQRALNEQSEQDSIKHKEQLAVVIGRLRGVEAAFKARMEEE KDATNAQILWSACTALARAIKSGPPGAPIEKIVRPLESEIKAVCKAAPKEDPLVMAAIKG IPVEAAKRGVFPEDILRERFLKVEQVARRLAMVPEEGAALPVYLLSYLQSYLMFKDVCPI SRSELEDKPFDVEDLNTFDILNRARYWLDRGDFKMTLRYMNLLKGAPRSVAKDWMNETRI LLETQQVVETLLAYAGAMGLMFLGAGDSK |
|
| |