| Protein: 110756792 XP_001120695.1 PREDICTED: hypothetical protein LOC726118 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 53.8 | 46.2 | 1.1645021 | ||
| Scape | 19.9 | 46.2 | 33.9 | 0.58702064 | 1.3628318 |
| Brain | |||||
| Crop | 49.3 | 50.7 | 0.9723866 | ||
| Eye | 45.1 | 32.5 | 22.4 | 2.013393 | 1.4508928 |
| Intestine | 34.1 | 17.1 | 48.8 | 0.69877046 | 0.35040984 |
| Leg, front | 30.9 | 20.2 | 48.8 | 0.6331967 | 0.41393444 |
| Leg, middle | 24.9 | 28.2 | 46.8 | 0.53205127 | 0.6025641 |
| Leg, rear | 23.3 | 21.5 | 55.1 | 0.4228675 | 0.39019963 |
| Mandibular gland | 6.3 | 93.7 | 0.06723586 | ||
| Rectum | 91.5* | 8.5 | 10.764706 | ||
| Salivary gland, cerebral | 17.4 | 8.7 | 73.9 | 0.23545331 | 0.11772666 |
| Salivary gland, thoracic | 32.9 | 36.9 | 30.2 | 1.089404 | 1.2218543 |
| Sternite | 29.5 | 22.6 | 48 | 0.6145833 | 0.47083333 |
| Tergite | 45.7 | 54.3 | 0.8416206 | ||
| Ventriculus | |||||
| Thoracic muscle | 23.6 | 61.8 | 14.7 | 1.6054422 | 4.2040815 |
| Fat body | 43.4 | 27.8 | 28.8 | 1.5069444 | 0.9652778 |
| Malpighian tubules | 22.4 | 62.1* | 15.5 | 1.4451613 | 4.0064516 |
| Nerve chord | 9.2* | 90.8 | 0.10132159 | ||
| Poison sac | |||||
| Sting | 42.6 | 57.4 | 0.74216026 | ||
| Heart | 37.5 | 29.3 | 33.2 | 1.129518 | 0.8825301 |
| Hypopharyngeal gland | 67.1 | 32.9 | 2.0395136 | ||
| Galea | 28 | 37.2 | 34.7 | 0.8069164 | 1.0720462 |
| Glossa | 32 | 25.5 | 42.4 | 0.754717 | 0.6014151 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 29.2 | 38.6 | 44 | 0.6636364 | 0.8772727 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MSGRPMKFPYTIAAKITRFPFHHYFVKSETGWVFRYWAISILICAPLWYKFQQLSHNPEN VKKWDEIHKHQFSGEMHH |
 Top
| |