Home List proteins by tissue Protein search Downloads Links
Protein: 66518223 XP_397047.2 PREDICTED: cytochrome c1 heme protein mitochondrial
Distribution (mouse over here
Sample of a protein distribution map.
for a definition map of the organs displayed below):
Drone Queen Worker











































































































































































































































The above diagram is generated from the following data:
(Organs are coloured according to percent relative expression - 100% = black, 0% = white)

Tissues Drone(D)% Queen(Q)% Worker(W)%     D/W         Q/W    
Flagellum 28.8 42.8 28.4 1.0140845 1.5070423
Scape 40.2 23.7 36 1.1166667 0.65833336
Brain 53.8 46.2 1.1645021
Crop 34.2 32.1 33.7 1.0148368 0.9525223
Eye 43.1 25.3 31.6 1.363924 0.8006329
Intestine 21.2 30.8 48 0.44166666 0.64166665
Leg, front 21.1 42.5 36.3 0.58126724 1.1707989
Leg, middle 37.1 39 23.9 1.5523013 1.6317992
Leg, rear 17.6 40.1 42.3 0.41607565 0.94799054
Mandibular gland 22.6 37.3 40.1 0.563591 0.9301746
Rectum 18.3 81.7 0.2239902
Salivary gland, cerebral 28.7 31 40.2 0.71393037 0.7711443
Salivary gland, thoracic 25.7 47 27.3 0.94139194 1.7216117
Sternite 28 29.1 43 0.6511628 0.67674416
Tergite 36 6* 58 0.62068963 0.10344828
Ventriculus 41.7 58.3 0.71526587
Thoracic muscle 37.6 62.4 0.6025641
Fat body 17.3 55.1 27.6 0.6268116 1.9963768
Malpighian tubules 38.8 26.7 34.5 1.1246377 0.773913
Nerve chord 39.9 25.5 34.6 1.1531792 0.7369942
Poison sac 0.4 99.6 0.004016064
Sting 50.8 49.2 1.0325203
Heart 43.3 25.6 31 1.3967742 0.82580644
Hypopharyngeal gland 89.1 10.9 8.174312
Galea 34.9 13.5 51.7 0.67504835 0.26112187
Glossa 33.6 25.2 41.2 0.815534 0.61165047
An asterisk (*) on D or Q values denote a significance difference from W (p<0.05).
Drone(D)% Queen(Q)% Worker(W)%     D/W         Q/W    
Whole Body Average 31.5 34.1 43 0.73255813 0.7930232
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their
whole body averages are significantly different (p<0.05) from each other.
Sequence: MAASLGRVYKIGLLKSNYGTLFNQQVHNFSTAKQWSRGRKVLLACLGVTAGGISALIYAL
DQSVKAFDMVAHPPTYKWGFYGMFSALDHRSLRRGWEVYKNVCSACHSLQYMAYRHLVGV
THTEEEVKAIAAEVQVQDGPDDQGNYFMRPGKLSDYIPPPYPNEEAARAANNGAYPPDLT
FIINATEHGENYVFSLLTGYCDPPAGIPIREGQYFNPYFVGGALGMPQIIYDEVIEYEDG
TPASASQLAKDIVEFLMWTSNSEHDERKRLTIKLLGVSSIVIPLLVYWKRHKWTTVKNTK
ILFTPRHKPPQ

Top