![]() |
||||||
| Home | List proteins by tissue | Protein search | Downloads | Links | ||
| Protein: 66518223 XP_397047.2 PREDICTED: cytochrome c1 heme protein mitochondrial |
Distribution (mouse over here![]() Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 28.8 | 42.8 | 28.4 | 1.0140845 | 1.5070423 |
| Scape | 40.2 | 23.7 | 36 | 1.1166667 | 0.65833336 |
| Brain | 53.8 | 46.2 | 1.1645021 | ||
| Crop | 34.2 | 32.1 | 33.7 | 1.0148368 | 0.9525223 |
| Eye | 43.1 | 25.3 | 31.6 | 1.363924 | 0.8006329 |
| Intestine | 21.2 | 30.8 | 48 | 0.44166666 | 0.64166665 |
| Leg, front | 21.1 | 42.5 | 36.3 | 0.58126724 | 1.1707989 |
| Leg, middle | 37.1 | 39 | 23.9 | 1.5523013 | 1.6317992 |
| Leg, rear | 17.6 | 40.1 | 42.3 | 0.41607565 | 0.94799054 |
| Mandibular gland | 22.6 | 37.3 | 40.1 | 0.563591 | 0.9301746 |
| Rectum | 18.3 | 81.7 | 0.2239902 | ||
| Salivary gland, cerebral | 28.7 | 31 | 40.2 | 0.71393037 | 0.7711443 |
| Salivary gland, thoracic | 25.7 | 47 | 27.3 | 0.94139194 | 1.7216117 |
| Sternite | 28 | 29.1 | 43 | 0.6511628 | 0.67674416 |
| Tergite | 36 | 6* | 58 | 0.62068963 | 0.10344828 |
| Ventriculus | 41.7 | 58.3 | 0.71526587 | ||
| Thoracic muscle | 37.6 | 62.4 | 0.6025641 | ||
| Fat body | 17.3 | 55.1 | 27.6 | 0.6268116 | 1.9963768 |
| Malpighian tubules | 38.8 | 26.7 | 34.5 | 1.1246377 | 0.773913 |
| Nerve chord | 39.9 | 25.5 | 34.6 | 1.1531792 | 0.7369942 |
| Poison sac | 0.4 | 99.6 | 0.004016064 | ||
| Sting | 50.8 | 49.2 | 1.0325203 | ||
| Heart | 43.3 | 25.6 | 31 | 1.3967742 | 0.82580644 |
| Hypopharyngeal gland | 89.1 | 10.9 | 8.174312 | ||
| Galea | 34.9 | 13.5 | 51.7 | 0.67504835 | 0.26112187 |
| Glossa | 33.6 | 25.2 | 41.2 | 0.815534 | 0.61165047 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 31.5 | 34.1 | 43 | 0.73255813 | 0.7930232 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MAASLGRVYKIGLLKSNYGTLFNQQVHNFSTAKQWSRGRKVLLACLGVTAGGISALIYAL DQSVKAFDMVAHPPTYKWGFYGMFSALDHRSLRRGWEVYKNVCSACHSLQYMAYRHLVGV THTEEEVKAIAAEVQVQDGPDDQGNYFMRPGKLSDYIPPPYPNEEAARAANNGAYPPDLT FIINATEHGENYVFSLLTGYCDPPAGIPIREGQYFNPYFVGGALGMPQIIYDEVIEYEDG TPASASQLAKDIVEFLMWTSNSEHDERKRLTIKLLGVSSIVIPLLVYWKRHKWTTVKNTK ILFTPRHKPPQ |
|
| |