| Protein: 254910938 NP_001011616.2 defensin-1 preproprotein |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | 98.3* | 1.7 | 57.82353 | ||
| Brain | |||||
| Crop | |||||
| Eye | |||||
| Intestine | |||||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | 2.4* | 1.4* | 96.2 | 0.024948025 | 0.014553015 |
| Salivary gland, thoracic | 7.8* | 92.2 | 0.0845987 | ||
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 99.1* | 0.9 | 110.11111 | ||
| Malpighian tubules | |||||
| Nerve chord | |||||
| Poison sac | |||||
| Sting | |||||
| Heart | 1.9* | 41.4 | 56.7 | 0.0335097 | 0.73015875 |
| Hypopharyngeal gland | 0.6* | 99.4 | 0.006036217 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 4.1 | 48.1 | 57.9 | 0.07081174 | 0.83074266 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MKIYFIVGLLFMAMVAIMAAPVEDEFEPLEHFENEERADRHRRVTCDLLSFKGQVNDSAC AANCLSLGKAGGHCEKGVCICRKTSFKDLWDKRFG |
 Top
| |