| Protein: 94158822 NP_001035313.1 odorant binding protein 14 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 65.3* | 21.4 | 13.3 | 4.9097743 | 1.6090225 |
| Scape | 30.5 | 44 | 25.5 | 1.1960784 | 1.7254902 |
| Brain | 55.2 | 44.8 | 1.2321428 | ||
| Crop | 6.8* | 28.5 | 64.7 | 0.10510046 | 0.4404946 |
| Eye | |||||
| Intestine | 1.7* | 78.3* | 20 | 0.085 | 3.915 |
| Leg, front | 11.2* | 55.5 | 33.3 | 0.33633634 | 1.6666666 |
| Leg, middle | 10.2* | 48.2 | 41.6 | 0.2451923 | 1.1586539 |
| Leg, rear | 12.4* | 25.6 | 62 | 0.2 | 0.41290322 |
| Mandibular gland | 3.9 | 45.8 | 50.3 | 0.07753479 | 0.91053677 |
| Rectum | 39.6 | 0.4* | 60.1 | 0.6589018 | 0.006655574 |
| Salivary gland, cerebral | 41.2 | 34.5 | 24.3 | 1.6954732 | 1.4197531 |
| Salivary gland, thoracic | 0* | 95.4* | 4.6 | 0 | 20.73913 |
| Sternite | 46.7 | 35 | 18.3 | 2.5519125 | 1.9125683 |
| Tergite | 14.4 | 31.2 | 54.4 | 0.2647059 | 0.5735294 |
| Ventriculus | |||||
| Thoracic muscle | 86.4 | 13.6 | 6.352941 | ||
| Fat body | 28.9 | 13.7 | 57.4 | 0.5034843 | 0.23867595 |
| Malpighian tubules | 9.2* | 17.5* | 73.3 | 0.1255116 | 0.23874488 |
| Nerve chord | 7.3 | 73.8 | 18.9 | 0.38624337 | 3.9047618 |
| Poison sac | 2.5 | 97.5 | 0.025641026 | ||
| Sting | 9.1* | 90.9 | 0.10011001 | ||
| Heart | 31.8 | 28.1 | 40.1 | 0.79301745 | 0.70074815 |
| Hypopharyngeal gland | 31 | 69 | 0.44927537 | ||
| Galea | 8.7* | 25.6 | 65.7 | 0.1324201 | 0.38964993 |
| Glossa | 16.1 | 8.7* | 75.1 | 0.21438083 | 0.11584554 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 20.3 | 37.3 | 46.6 | 0.4356223 | 0.80042917 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MKTIVLIFGFCVCVGALTIEELKTRLHTEQSVCKTETGIDQQKANDVIEGNIDVEDKKVQ LYCECILKNFNILDKNNVFKPQGIKAVMELLIDENSVKQLVSDCSTISEENPHLKASKLV QCVSKYKTMKSVDFL |
 Top
| |