| Protein: 66504967 XP_396134.2 PREDICTED: tricarboxylate transport protein mitochondrial-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 27 | 73 | 0.369863 | ||
| Scape | 30.8 | 20.2 | 49 | 0.62857145 | 0.4122449 |
| Brain | |||||
| Crop | 56.9 | 43.1 | 1.3201857 | ||
| Eye | |||||
| Intestine | 6* | 39.1 | 54.9 | 0.10928962 | 0.712204 |
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | 80* | 20 | 4 | ||
| Salivary gland, thoracic | 47.6 | 6* | 46.5 | 1.0236559 | 0.12903225 |
| Sternite | 4.4* | 21.9 | 73.6 | 0.05978261 | 0.29755434 |
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 9.1 | 25.2 | 65.7 | 0.13850836 | 0.38356164 |
| Malpighian tubules | 29.9 | 41.6 | 28.4 | 1.0528169 | 1.4647887 |
| Nerve chord | 14.7 | 56.2 | 29.1 | 0.5051546 | 1.9312714 |
| Poison sac | |||||
| Sting | |||||
| Heart | 1.3 | 57.7 | 40.9 | 0.03178484 | 1.4107579 |
| Hypopharyngeal gland | 69.3 | 30.7 | 2.257329 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 19 | 43.1 | 46.3 | 0.41036716 | 0.93088555 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MDISLLIYKLLQQSSTTSTFQNNPFPHRPWLTDTGVAAAVAKGGVKGIVAGGITGGIEIC ITYPTEYVKTQLQLDAKSGIDKQYTGAWDCITKTIKNRGFFGLYRGLSVLLYGSIPKSAV RFGSFEKMKELLAGPDGKLTKKNSFLAGLCAGTAEAIFAVTPMETIKVKFINDQRSPNPK YRGFLHGVGMITREYGIRGIYQGLVPTILKQSSNQAIRFCTIETLKDWYRGGDKDVVIPK VVTGIFGAIAGACSVFGNTPIDVVKTRMQGLEAAKYKNSLDCVRQIWMNEGPMAFYKGTI PRLSRVCLDVAITFMIYDSFKELFDRIWP |
 Top
| |