| Protein: 66519254 XP_625208.1 PREDICTED: soluble NSF attachment protein |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 39.1 | 26.6 | 34.2 | 1.1432749 | 0.7777778 |
| Scape | 41.4 | 27.2 | 31.5 | 1.3142858 | 0.8634921 |
| Brain | 46.2 | 19.9 | 33.9 | 1.3628318 | 0.58702064 |
| Crop | 38.4 | 25.3 | 36.3 | 1.0578512 | 0.6969697 |
| Eye | 61.4 | 38.6 | 1.5906736 | ||
| Intestine | 21.6 | 39.2 | 39.2 | 0.5510204 | 1 |
| Leg, front | 54.5 | 45.5 | 1.1978022 | ||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | 48.1 | 11.1 | 40.9 | 1.1760391 | 0.27139366 |
| Salivary gland, thoracic | 52.5 | 19 | 28.5 | 1.8421053 | 0.6666667 |
| Sternite | 25.8 | 39.4 | 34.9 | 0.739255 | 1.1289399 |
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | 73.6 | 26.4 | 2.7878788 | ||
| Fat body | 50.3 | 25.9 | 23.8 | 2.1134453 | 1.0882353 |
| Malpighian tubules | 48.3 | 24.6 | 27.1 | 1.7822878 | 0.90774906 |
| Nerve chord | 34.9 | 24.2 | 40.9 | 0.85330075 | 0.591687 |
| Poison sac | |||||
| Sting | |||||
| Heart | 28.8 | 28.5 | 42.8 | 0.6728972 | 0.66588783 |
| Hypopharyngeal gland | 53.7 | 46.3 | 1.1598272 | ||
| Galea | |||||
| Glossa | 53.6 | 46.4 | 1.1551725 | ||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 44.3 | 29.9 | 36.3 | 1.2203857 | 0.8236915 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MADNEQKAMQLLVEAEKKLTSSKGFFGSLFGGSSKFEEAVECYQRAANMFKMAKNWSSAG SAFYEAAELHAKAGNRHDAATNYVDAANCFKKSNINEAISCLLKAIEIYTDMGRFTMAAK HHQSIAEMYESEAVDLERAVHHYEQAADYFRGEESNSSANKCLLKVAQYAAQLENYEKAI QIYEQVASASLESSLLKYSAKEYFFRAALCHLCVDVLNAQHAIERYQEQYPAFQDSREYK LIKTLIEHIEEQQLEGFTEAVKEYDSISRLDQWYTTVLLRIKKQVDDNPDLR |
 Top
| |