| Protein: 94158810 NP_001035314.1 odorant binding protein 13 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 39.9* | 54.2* | 5.9 | 6.762712 | 9.18644 |
| Scape | 5.5 | 94.5 | 0.05820106 | ||
| Brain | |||||
| Crop | |||||
| Eye | |||||
| Intestine | |||||
| Leg, front | |||||
| Leg, middle | 14.5* | 85.5 | 0.16959064 | ||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | |||||
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | |||||
| Malpighian tubules | |||||
| Nerve chord | |||||
| Poison sac | |||||
| Sting | |||||
| Heart | 79.9* | 20.1 | 3.9751244 | ||
| Hypopharyngeal gland | 5.1 | 94.9 | 0.05374078 | ||
| Galea | 16.8* | 0.9* | 82.3 | 0.20413123 | 0.010935601 |
| Glossa | 39.8 | 1.2* | 59 | 0.6745763 | 0.020338982 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 44.1 | 13.6 | 63.2 | 0.6977848 | 0.21518987 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MKTIIFIFAFCLVGILAVSEESINKLRKIESVCAEENGIDLKKADDVKKGIFDKNDEKLA CYVDCMLKKVGFVNADTTFNEEKFRERTTKLDSEQVNRLVNNCKDITESNSCKKSSKLLQ CFIDNNLMKIFE |
 Top
| |