| Protein: 48102645 XP_395405.1 PREDICTED: prefoldin subunit 5-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 45.1 | 29.7 | 25.2 | 1.7896825 | 1.1785715 |
| Scape | 42.5 | 20.1 | 37.4 | 1.1363636 | 0.53743315 |
| Brain | 25.4 | 74.6 | 0.34048256 | ||
| Crop | |||||
| Eye | |||||
| Intestine | |||||
| Leg, front | 64.1 | 35.9 | 1.7855153 | ||
| Leg, middle | 44.3 | 55.7 | 0.79533213 | ||
| Leg, rear | |||||
| Mandibular gland | 12 | 88 | 0.13636364 | ||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 40.2 | 21 | 38.8 | 1.0360825 | 0.5412371 |
| Sternite | |||||
| Tergite | |||||
| Ventriculus | 50.9 | 49.1 | 1.0366598 | ||
| Thoracic muscle | |||||
| Fat body | 35.1 | 36.9 | 28 | 1.2535714 | 1.3178571 |
| Malpighian tubules | 27.8 | 35.4 | 36.8 | 0.7554348 | 0.9619565 |
| Nerve chord | 24.9 | 32.3 | 42.8 | 0.5817757 | 0.7546729 |
| Poison sac | |||||
| Sting | |||||
| Heart | 46.6 | 53.4 | 0.87265915 | ||
| Hypopharyngeal gland | 29.5 | 70.5 | 0.41843972 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 36.5 | 33.8 | 48.9 | 0.7464213 | 0.6912065 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MSEVSMTETPHLQKIDLTTLNLQQLTMLKQQLDQELGVFQDSLQTLKIAQSKFQESGSCL EKISPSLEGNEILVPLTGSMYVVGKLVETDNVLIDIGTGYYAQKKVIDAKDYFDRRVAYV TEQMEKIQQLGLEKSKVRDATVDVIEMKLQNQVPKED |
 Top
| |