| Protein: 66519534 XP_624890.1 PREDICTED: GTP:AMP phosphotransferase mitochondrial |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 64.9 | 35.1 | 1.8490028 | ||
| Scape | 12.1* | 42.8 | 45.1 | 0.2682927 | 0.9490022 |
| Brain | 80* | 20 | 4 | ||
| Crop | |||||
| Eye | |||||
| Intestine | |||||
| Leg, front | 29.2 | 40.4 | 30.3 | 0.96369636 | 1.3333334 |
| Leg, middle | 49.2 | 50.8 | 0.96850395 | ||
| Leg, rear | 34.9 | 42.4 | 22.7 | 1.537445 | 1.8678414 |
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 16.5 | 47.9 | 35.6 | 0.46348315 | 1.3455056 |
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | 13.4 | 34.1 | 52.4 | 0.2557252 | 0.65076333 |
| Fat body | 82.8* | 17.2 | 4.8139534 | ||
| Malpighian tubules | 54.2 | 45.8 | 1.1834061 | ||
| Nerve chord | 53.5 | 46.5 | 1.1505376 | ||
| Poison sac | |||||
| Sting | |||||
| Heart | 16.8 | 63.9* | 19.3 | 0.8704663 | 3.310881 |
| Hypopharyngeal gland | |||||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 29.6 | 54.2 | 35.1 | 0.8433049 | 1.5441595 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MVALSTWCAKAAAFRAVILGAPASGKGTMSARIVEQFKLTHISSGDKLRLHMNNKTELGK AVSNYVLSGKFVPDDIMISMINEEIKAVGKQNWLLDGFPRTLTQAEKLQKIHPINLVLYL DVPFEVILNRVKNRWVHLPSGRVYNIGFNSPKVPGKDDVTGEPLSKRDDDKIEIVEKRLQ EYSNATKPILTFYSNLGLLNTFQGNTTDEIWPNIKKVVAKFLLQ |
 Top
| |