| Protein: 328779296 XP_003249626.1 PREDICTED: hypothetical protein LOC100576341 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | 65.7* | 10.1 | 24.2 | 2.714876 | 0.41735536 |
| Brain | |||||
| Crop | |||||
| Eye | |||||
| Intestine | |||||
| Leg, front | 74.2* | 25.8 | 2.875969 | ||
| Leg, middle | 66.1* | 12.9 | 21 | 3.147619 | 0.6142857 |
| Leg, rear | |||||
| Mandibular gland | 27.2 | 14 | 58.8 | 0.46258503 | 0.23809524 |
| Rectum | |||||
| Salivary gland, cerebral | 38 | 18.8 | 43.2 | 0.8796296 | 0.4351852 |
| Salivary gland, thoracic | |||||
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | |||||
| Malpighian tubules | |||||
| Nerve chord | |||||
| Poison sac | |||||
| Sting | |||||
| Heart | |||||
| Hypopharyngeal gland | |||||
| Galea | 32.4 | 9.2* | 58.4 | 0.55479455 | 0.15753424 |
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 50.6 | 13 | 38.6 | 1.3108808 | 0.33678755 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MFLGRTISTPIANVWLSPVGSLTPLRQYHIQDGSGGYHYSFTGPHHAKSESSSNGITQGG YSYVDANGILQTVTYTADDQNGFRVRASNLPQPPKNDLQTIQDTPEVAAGKKNHLEELQK SQLGDPSSYQSNILSYKILPSYFSFAQLTKDEEKNLAAEEIAQTTKNPFLLSRTEAEGIE VPKPDPSLTKISQPLATISTSSSSRAGQQKEQGNPLQLGKLVPLDTIQRPVTLPAPYVVP VLPLHRLLHSSLHHTQDSLGRYDYTYTGDSSAKTESRSLDGTTRGAYSYIDPNGVLQQVH YVADHNGFRVMATNLPEAK |
 Top
| |