![]() |
||||||
| Home | List proteins by tissue | Protein search | Downloads | Links | ||
| Protein: 110776794 XP_623427.2 PREDICTED: probable cytochrome P450 6a14 isoform 1 |
Distribution (mouse over here![]() Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 23.1* | 76.9 | 0.30039012 | ||
| Scape | 29.3 | 70.7 | 0.41442716 | ||
| Brain | 20.3 | 79.7 | 0.25470513 | ||
| Crop | |||||
| Eye | |||||
| Intestine | |||||
| Leg, front | 25.7* | 74.3 | 0.34589502 | ||
| Leg, middle | 24.9 | 16.9* | 58.1 | 0.42857143 | 0.2908778 |
| Leg, rear | 42.2 | 16.4 | 41.4 | 1.0193237 | 0.39613527 |
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 26.7 | 73.3 | 0.36425647 | ||
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 46.7 | 53.3 | 0.8761726 | ||
| Malpighian tubules | 42.9 | 14.1* | 42.9 | 1 | 0.32867134 |
| Nerve chord | 17.2 | 54.2 | 28.6 | 0.6013986 | 1.8951049 |
| Poison sac | |||||
| Sting | |||||
| Heart | 8 | 55.2 | 36.8 | 0.2173913 | 1.5 |
| Hypopharyngeal gland | |||||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 26.4 | 30.6 | 57.8 | 0.4567474 | 0.5294118 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MDFFQIFCAICIMLLAIYYYYTSIYNYWKVRGIPGPEPTIIIGNFMEVFLKKISINDKLR FLYNKYKNEPMFGIFEGSSPILVLNDLDLIKDVLIKDFSIFSNRGFRIFPKAEPLGEHLF ALETERWRPMRAKLSPIFTSGKLKEMFPLIIECSKNMEPYLDKIAERGKYIECRDLAAKF TTDVIGSCAFGIDMNSISDKDSEFRIIGRKLFTPTFKTIVRDVCRQFLPGLYDVIGHKLQ IEEVNEFLTNLIKDTINYRKENKIVRPDFVNTLIELKDHPEKLETIKLTDSMIASQAFVF FVAGFETSSSTISHALYELAQNQEIQDKLREEIREVYEKHGELTYDVIKNMKYLDKVLKE TLRKYPIMAMLTREAQENYTFKGTKVTIEKGIKVWILPYGIQNDPDIFPNPDIFDPERFD EEAVAARHPMSYLPFGDGPRNCIGARFAQFQSKIGIITIVRNHKIDVCEQTKIPYESDPF QFLLALKGGINLKISKI |
|
| |